SecReT6
Protein ID: 377807402
SecReT6 ID515
T6SS typeN/A
Gene symbol-
Locus tagBYI23_C000100
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]13981..15432 [-]
Producthypothetical protein
NoteTssC
UniProt IDG8MIP3
KEGG IDbyi:BYI23_C000100
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.40E-169, Aligned region: 61..479
Protein Sequence: 483 a.a.     [Download]
>gi|377807402|ref|YP_004978594.1| hypothetical protein BYI23_C000100 [Burkholderia sp. YI23]
MTSVIRLAQKRRTSLMVQPHPPAVEPASVQGPISDKSSEDVYRSLLESIDLGPDSGWTDFCIAECDEFIS
RQLDEILHHPNFQRLESAWRGLKFLVDQTDFRQRVVIEVLDVSKGVLRQDFEDAPDVAHSGLFWQTYTQE
YDTPGAHPFSAVISNFEFDHGPQDIALLRDISKVAAAAHMPFIGAVSPQFFGKVSMEDVVSIRDIGDYFD
RAEYLRWKSLRKSEDARYLGLTLPRFLARLPYDADTAPTRAFNYTENVGSDQRHYLWANASFAFATNLVR
SFVRNGWCVQIRGPQAGGLVEALPTQLYDLGTGGLAKIPTQALIPEAREFEFAHLGLIPLSHYKNHDYAC
FYSAHSVQRPENFDTKEASANSRVNARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELELNSWVRTLV
TEMTAPGDDLQASHPLRDARVEVEDIEDNPGFFRVKLYIVPHFQIEGMDINLALVSQMPKAKN
 
Nucleotide Sequence: 1452 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c15432-13981 Burkholderia sp. YI23 chromosome 3, complete sequence
ATTACATCAGTCATTCGTCTTGCGCAGAAAAGAAGAACGAGTCTCATGGTTCAGCCCCACCCTCCTGCTG
TCGAGCCTGCCTCCGTGCAAGGACCGATCTCCGATAAATCGAGCGAAGATGTCTATCGGTCGCTCCTTGA
GTCCATCGATCTCGGGCCCGACTCCGGATGGACTGATTTCTGCATAGCCGAATGCGACGAGTTCATTAGC
CGCCAGCTCGACGAGATCCTGCATCACCCCAACTTCCAGCGCCTGGAGTCCGCCTGGCGCGGTCTAAAGT
TCCTCGTCGATCAAACCGACTTTCGCCAGCGCGTCGTCATCGAAGTGCTCGACGTATCGAAAGGGGTGCT
GCGCCAGGATTTCGAGGACGCGCCGGACGTCGCTCATAGCGGATTGTTCTGGCAGACCTACACGCAGGAA
TACGACACACCGGGCGCGCATCCCTTCTCGGCCGTCATCTCGAACTTCGAATTCGATCATGGTCCGCAAG
ATATCGCGCTCTTGCGCGATATCTCGAAGGTGGCCGCCGCTGCCCATATGCCGTTTATCGGGGCGGTGTC
ACCGCAATTCTTCGGCAAGGTGTCTATGGAAGACGTCGTGAGTATTCGCGATATCGGCGATTACTTCGAT
CGTGCTGAATATCTGCGATGGAAGAGCCTGCGCAAGTCCGAGGACGCACGCTATCTCGGGCTCACGCTGC
CGCGCTTTCTGGCGCGGCTGCCCTACGATGCCGATACCGCACCGACACGCGCATTCAACTACACCGAAAA
CGTTGGGAGCGATCAGCGGCACTATCTCTGGGCGAACGCATCGTTCGCTTTCGCAACTAATCTGGTGCGC
AGTTTCGTTCGTAACGGCTGGTGTGTTCAGATTCGCGGACCGCAGGCGGGGGGCCTCGTCGAAGCCTTGC
CCACCCAGCTTTACGATCTCGGCACAGGCGGGCTCGCCAAGATTCCAACCCAGGCACTCATCCCCGAAGC
ACGCGAGTTCGAATTCGCCCATCTCGGTCTGATTCCGCTCTCGCACTACAAGAATCACGATTACGCCTGT
TTCTATTCGGCACACTCCGTGCAGCGCCCCGAGAATTTCGATACCAAGGAGGCGAGCGCCAACAGCCGCG
TGAATGCACGGCTGCCATACATCTTTCTGTTATCGAGAATCGCGCACTACCTCAAGCTGATCCAGCGCGA
GAACATCGGCACGACCAAGGACAGGCGCCTGCTCGAACTCGAACTCAACAGCTGGGTGAGAACGCTCGTC
ACCGAGATGACCGCACCGGGCGACGATTTGCAAGCCTCGCACCCACTACGCGATGCGCGAGTGGAAGTCG
AGGATATCGAGGACAACCCAGGGTTCTTTCGCGTCAAGCTCTATATCGTGCCGCATTTCCAGATCGAGGG
TATGGACATCAATCTTGCACTCGTCTCGCAGATGCCCAAGGCGAAGAACTAA