SecReT6
Protein ID: 377807403
SecReT6 ID515
T6SS typeN/A
Gene symbol-
Locus tagBYI23_C000110
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]15712..18060 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDG8MIP4
KEGG IDbyi:BYI23_C000110
PDB IDNA
Domain hit(s) vs Pfam DUF2345 [PF10106], Evalue: 8.50E-48, Aligned region: 600..748
Phage_GPD [PF05954], Evalue: 5.30E-38, Aligned region: 74..344
Phage_GPD [PF05954], Evalue: 5.30E-38, Aligned region: 568..589
T6SS_Vgr [PF13296], Evalue: 1.40E-33, Aligned region: 478..583
T6SS_Vgr [PF13296], Evalue: 1.40E-33, Aligned region: 590..610
Phage_base_V [PF04717], Evalue: 5.50E-09, Aligned region: 378..464
Protein Sequence: 782 a.a.     [Download]
>gi|377807403|ref|YP_004978595.1| Rhs element Vgr protein [Burkholderia sp. YI23]
MSSVLDDGSRLVASGGAMPGRQAYHLEVPSQEALAGEFSVVSWEVKERMGQPVVAKLCVTHPRKVSRRHF
LSRDAAFIMTPLGEKSRRFSGYIASYATIKTTADFTSYEITLVSHLGRLDVVNSKIYQHKTTPEIIESIL
LSHGIPAHLISIRLRANYQQHAFRFQYQQTDLAYVQMLCQKAGIYLYVIETEHGDQIVLGDDVDHYVHDA
KLVLPFREPSGLNAAAESVYELVAKATTVPKSIVVAEYNPERAYERYKGEENIAPQDDTTYGSPYIYGTN
HEDQKGARLQAQLRHEAEIAWQIVYEGESTARELHVARVFGMDEEVDDAPDGLLIFEITHRGARDQSYTN
SFKAIPADRRFRLKFEDCTWPKISGSLSARVTSPDKYKYAYLTAAGYYTVRFDLDFADWPNGGESVPLRM
AKPFAGKLQTGMHFPALDNDEAVIEFRDGDPDKPYIAAFQHHSQAVDLVTSERRWLSRNEIRTQSNNKLR
MEDWAGQEGIKLSTEHSGKSQLNLGYLVDNKLARRGEGFELRTSAQGAVRAGGGLFISSNDRPNATGAQL
DMREALQQLGAAQSQMRMLAQAAQAAQADAADAKAMNDVLQNQIKDLQQAVMVLSASASIAITSPETIQH
SAGSNLTLTSGENVDVGAMRKFTLAAGELISFFAGKMGIKLFASKGKVDIQAQSDELALAALKDVTVTST
SGKLILTAKNEVWIGAGGSYIKINGNRIENGTAGDIIEKCASWDIDSSTSSTRTAALPVAQDCEIPRQNA
ASRHEALVPLDA
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|377807392|ref|NC_016590.1|:15712-18060 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGTCCAGTGTGTTGGACGATGGGAGCAGGCTTGTCGCGAGCGGGGGCGCCATGCCCGGTCGCCAAGCGT
ATCACCTTGAAGTGCCGAGCCAGGAAGCGCTCGCGGGGGAGTTCTCGGTTGTTTCGTGGGAAGTGAAGGA
ACGCATGGGGCAGCCGGTGGTGGCTAAGCTGTGCGTGACGCATCCGCGGAAGGTATCGCGCAGGCATTTC
CTGAGCCGCGACGCCGCGTTCATCATGACTCCGCTCGGCGAGAAGTCCCGACGCTTCTCAGGCTACATCG
CCTCATACGCGACGATCAAGACGACGGCCGATTTCACGAGTTACGAAATCACGCTGGTGTCCCATCTGGG
TCGGCTTGATGTTGTCAATTCAAAAATATATCAACATAAGACAACGCCAGAGATAATCGAAAGCATCTTG
CTTTCGCACGGGATTCCTGCGCATCTGATCAGTATCCGGCTGCGGGCGAATTATCAGCAGCACGCGTTTC
GCTTCCAATATCAGCAGACTGATCTGGCATATGTGCAGATGCTGTGCCAGAAGGCTGGCATCTACCTGTA
TGTGATCGAGACAGAGCACGGGGACCAGATCGTCCTGGGCGACGACGTCGATCATTACGTCCATGACGCC
AAGCTGGTGCTGCCATTCAGAGAACCATCAGGTCTGAACGCCGCCGCTGAATCGGTGTATGAACTCGTGG
CGAAAGCGACGACGGTGCCGAAGTCGATTGTCGTCGCGGAATATAATCCTGAGCGCGCCTACGAGCGATA
CAAGGGCGAAGAGAACATCGCACCTCAGGATGATACCACGTATGGCAGTCCTTACATCTACGGGACGAAC
CACGAGGACCAGAAAGGCGCCCGTCTTCAGGCACAACTGCGCCACGAGGCGGAGATCGCTTGGCAGATCG
TCTACGAGGGCGAGAGCACGGCGCGTGAATTGCACGTGGCGCGCGTATTTGGCATGGACGAGGAAGTCGA
TGACGCGCCCGATGGGTTGTTGATTTTCGAGATCACGCATCGCGGCGCGCGTGACCAGTCGTACACCAAC
AGCTTCAAGGCGATTCCCGCTGACCGACGTTTCAGGCTGAAATTCGAGGACTGCACGTGGCCGAAAATCT
CTGGCTCACTCAGTGCGCGCGTGACAAGTCCTGACAAATACAAGTATGCCTATCTAACCGCAGCCGGCTA
TTACACAGTTCGCTTCGATCTGGATTTCGCAGACTGGCCCAACGGCGGTGAAAGCGTGCCGCTGCGGATG
GCCAAGCCGTTCGCGGGCAAGCTGCAAACGGGGATGCACTTCCCGGCGCTGGACAACGATGAGGCGGTGA
TCGAATTTCGGGATGGCGACCCGGACAAGCCCTATATTGCTGCGTTCCAGCATCACAGTCAGGCAGTGGA
TCTGGTCACGAGTGAGCGGCGCTGGCTGTCGAGAAACGAGATCCGCACGCAAAGCAATAACAAGCTGCGC
ATGGAGGATTGGGCGGGGCAGGAAGGCATCAAGCTCAGCACGGAGCACTCGGGCAAGTCGCAGCTCAATC
TAGGTTATCTGGTAGATAACAAGCTGGCACGGCGCGGGGAAGGTTTTGAGCTTCGCACGTCGGCGCAAGG
TGCAGTCCGCGCAGGTGGCGGCCTCTTCATCTCGTCGAATGATCGCCCCAACGCTACCGGCGCTCAACTC
GACATGCGCGAAGCATTGCAACAACTGGGTGCTGCGCAGTCGCAGATGAGGATGCTAGCACAGGCGGCCC
AAGCTGCGCAGGCCGATGCTGCGGATGCCAAAGCGATGAACGACGTGCTCCAAAATCAGATCAAAGATTT
GCAGCAGGCAGTCATGGTGCTTTCGGCAAGTGCATCCATCGCAATTACTTCACCCGAGACCATTCAGCAC
AGTGCTGGGAGTAACCTCACCCTTACCTCAGGCGAGAATGTCGACGTCGGCGCCATGCGCAAATTCACAC
TTGCCGCCGGAGAACTGATCAGTTTTTTTGCCGGGAAGATGGGCATCAAGCTCTTTGCGAGCAAGGGAAA
GGTGGATATACAGGCCCAGTCGGACGAGCTTGCACTGGCCGCCCTCAAGGACGTTACCGTCACCAGCACG
AGCGGTAAGCTGATCCTCACGGCGAAAAACGAAGTGTGGATTGGTGCAGGCGGCTCTTACATCAAAATCA
ACGGCAACCGTATCGAAAACGGCACGGCTGGCGACATCATCGAGAAATGCGCGTCATGGGACATTGATTC
ATCAACAAGTTCGACGCGCACCGCTGCTTTACCGGTCGCGCAGGACTGCGAGATTCCTCGCCAGAACGCC
GCATCGCGCCATGAAGCGCTTGTTCCGCTGGATGCATGA