SecReT6
Protein ID: 377807409
SecReT6 ID515
T6SS typeN/A
Gene symbolimpA
Locus tagBYI23_C000170
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]28754..30340 [+]
Productprotein ImpA
NoteTssA
UniProt IDG8MIQ0
KEGG IDbyi:BYI23_C000170
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.60E-16, Aligned region: 65..123
ImpA-rel_N [PF06812], Evalue: 3.60E-16, Aligned region: 159..179
ImpA-rel_N [PF06812], Evalue: 3.60E-16, Aligned region: 395..417
Protein Sequence: 528 a.a.     [Download]
>gi|377807409|ref|YP_004978601.1| protein ImpA [Burkholderia sp. YI23]
MFTNLLNALFGTRQPADLARAAQPQWNDWLAPIRADAPTGDDPGYDDDFLAIKDEVAKLSNIDDALIVES
AERLIKQRAKDVRLAVYYLYGRLRRDGAEGVASGFEFLSALVDRFDDALLPARSVSRKAAFEWLCGSTFA
DRLDAVQGLTGPLLERTLSALALIDERLASWPEEARPVLAPLFRRFEGRVEPPPTEEDKQSTTSPATTAA
LPASSDVSSTAELLDRARLMARFLREQPQGYLAAYRLMRCIRWDTLIEVPPFDAGGKTRLVAPRAELRAN
LKRLMLQKQWPELLERVEMAFSEGANHFWLDLQYYAFVAQEQAGGEYAQVRETAATDCALMLERLPGLEH
LLFSDGSAFADDATLEWIARYATVRDIERGDAGAPVSATAASTDWAETEAQANYMAAQQGLDAALAWLQR
LPAQDETQIAGGGRERFTRQLVMARVAERAERSDTALYLLTTLDTDVARYQLARWEPSLAFEVKHHLLRI
LKSRFNRKDADKPALVTRIDTLTADLTAIDAARAVALA
 
Nucleotide Sequence: 1587 bp     [Download]
>gi|377807392|ref|NC_016590.1|:28754-30340 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGTTCACCAACCTCCTCAACGCGCTCTTCGGCACGCGCCAACCCGCCGATCTCGCCCGCGCCGCTCAAC
CGCAATGGAACGACTGGCTCGCACCAATCCGCGCGGACGCCCCCACTGGCGACGACCCCGGCTACGACGA
CGACTTCCTCGCCATCAAGGACGAGGTCGCCAAGCTCTCCAACATCGATGACGCGCTGATCGTCGAATCG
GCCGAGCGGCTTATCAAGCAACGCGCCAAGGACGTGCGTCTGGCGGTTTATTACCTCTACGGCCGCCTGC
GTCGCGATGGCGCCGAAGGCGTCGCCTCCGGCTTCGAATTCCTGTCAGCACTCGTCGATCGCTTCGACGA
TGCCTTGCTGCCCGCGCGGTCGGTTTCACGCAAGGCCGCTTTCGAATGGCTGTGCGGCAGCACCTTCGCG
GATCGGCTCGATGCCGTGCAGGGCCTCACCGGCCCGCTGCTCGAACGCACGCTTTCAGCCCTCGCGCTGA
TCGACGAGCGCCTCGCCTCGTGGCCCGAAGAGGCACGTCCGGTACTGGCGCCGCTGTTTCGCCGCTTCGA
AGGCCGGGTCGAGCCGCCGCCGACGGAAGAAGATAAACAAAGCACCACGTCTCCAGCGACGACAGCCGCA
TTGCCAGCATCGTCGGACGTCTCATCCACAGCCGAACTGCTCGACCGCGCTCGTCTGATGGCCAGGTTCC
TGCGCGAGCAGCCGCAAGGCTATCTCGCCGCCTACCGCCTGATGCGCTGCATCCGCTGGGACACGCTTAT
CGAAGTGCCGCCGTTCGACGCAGGCGGCAAGACGCGCCTCGTCGCGCCACGGGCCGAGTTGCGCGCCAAC
CTGAAGCGTTTGATGCTGCAAAAGCAGTGGCCGGAGTTGCTCGAACGCGTCGAGATGGCCTTTTCCGAAG
GCGCGAATCACTTCTGGCTCGACCTGCAGTACTACGCCTTCGTCGCGCAGGAACAAGCCGGTGGCGAATA
TGCGCAAGTGCGCGAAACCGCCGCCACCGACTGCGCGCTGATGCTCGAACGCCTGCCCGGTCTCGAGCAC
CTGCTGTTCTCCGACGGCTCCGCGTTCGCCGACGACGCCACGCTCGAATGGATCGCGCGCTACGCGACGG
TGCGCGACATCGAACGAGGCGATGCAGGCGCGCCCGTGAGCGCCACCGCAGCCAGCACGGACTGGGCCGA
AACCGAAGCGCAGGCCAACTACATGGCCGCACAACAAGGTCTGGACGCGGCGCTCGCTTGGCTGCAACGT
CTGCCCGCGCAGGACGAAACGCAGATCGCCGGCGGCGGGCGCGAACGCTTTACGCGCCAACTCGTGATGG
CGCGCGTAGCCGAGCGCGCCGAACGTTCCGACACCGCGCTCTATCTGCTCACCACGCTCGACACCGATGT
CGCGCGCTATCAGCTTGCGCGCTGGGAGCCGTCGCTTGCGTTCGAGGTCAAGCACCATCTGCTGCGCATC
CTGAAGAGCCGCTTCAATCGCAAGGATGCGGACAAACCCGCGCTCGTCACACGCATCGACACGCTCACGG
CGGATTTAACGGCGATCGATGCCGCGCGCGCCGTCGCACTCGCATAA