SecReT6
Protein ID: 377807410
SecReT6 ID515
T6SS typeN/A
Gene symbol-
Locus tagBYI23_C000180
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]30359..32182 [+]
Producthypothetical protein
NoteTssF
UniProt IDG8MIQ1
KEGG IDbyi:BYI23_C000180
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.60E-178, Aligned region: 11..605
Protein Sequence: 607 a.a.     [Download]
>gi|377807410|ref|YP_004978602.1| hypothetical protein BYI23_C000180 [Burkholderia sp. YI23]
MTSPTRDNEILRYYEAEMRYLREAGREFARAFPDRARELDLDRLGERDPHVERLFEGFAFLMGRLRHKLD
DELPELTEGLVSMLWPHYLRMIPSLAILELQPNLGALQKHEIIAAGLEATSDPISTGAAAGTTGSDAQIA
CVYRTTQPVDIYPLSLTEAGTYAREDGRSVVRLRFAIQEQAQRDRLEVPRLRFYLHADRPVALALYAALS
ETPVAVQVRVPGFPEDRPGTPQTMPGLRLAPAGFATDERLWPKADNAFGGYQLLLEYFTFPEKFMFIDLL
GLDMKAIPASIRSFDVEIVLAKSYPDDMRFTEENVRLYCTPVINLFPIAADPVNVTQLETEYRVRAREQF
GSLVDIYSVDAVEGIDGGRRFEYVPFAAFKHRGGMLRHDLPERYFHTRMRRGPSGRFDTWVVLGGHAWEH
ARALPKEKLSLSVTGTNGMLPRKALREAGITRMRGGFTNIGGVRNLTAPTLPVYPPTGDRFQWRVLSHLA
PNYLSLLDAEMLRGSLALYDWTEGELNRRRIEAITDVKHRPLSKLVKGGLMRGVEITVTIDSGRFAGDGD
IDLFGAMLNRFLGLYAMLNLYTKLVIVSQPTGKRLEWPETKGEGAPF
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|377807392|ref|NC_016590.1|:30359-32182 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGACAAGTCCGACCCGGGACAATGAAATCCTTCGCTATTACGAAGCGGAGATGCGCTATCTGCGCGAGG
CTGGCCGCGAATTCGCACGCGCTTTCCCTGACCGCGCGCGCGAACTCGATCTCGACCGGCTCGGCGAGCG
CGACCCGCACGTGGAGCGCTTGTTCGAAGGCTTCGCCTTCCTGATGGGACGGCTGCGTCACAAGCTCGAC
GATGAATTGCCCGAACTCACCGAAGGTCTGGTGAGCATGTTGTGGCCGCACTATCTGCGCATGATTCCGT
CGCTCGCGATTCTCGAACTGCAACCGAACCTCGGCGCGCTGCAAAAGCACGAGATCATCGCCGCGGGACT
CGAAGCAACCTCCGATCCGATCTCGACGGGCGCAGCCGCAGGAACAACGGGAAGCGACGCGCAGATCGCG
TGCGTTTACCGCACCACGCAGCCGGTCGATATCTATCCGTTGTCCCTGACCGAAGCGGGCACCTACGCGC
GGGAAGATGGCCGCTCGGTCGTGCGGCTGCGCTTCGCGATTCAGGAGCAGGCGCAGCGCGACCGGCTCGA
AGTTCCGCGCCTGCGCTTCTACCTGCACGCGGACCGGCCTGTCGCGCTGGCGTTGTATGCGGCGCTCTCG
GAAACGCCCGTGGCCGTTCAGGTGCGCGTGCCCGGCTTTCCGGAGGATCGGCCCGGCACGCCGCAGACGA
TGCCCGGCTTGCGCCTCGCGCCCGCGGGCTTTGCTACCGACGAGCGTCTGTGGCCGAAGGCCGACAACGC
GTTCGGCGGCTATCAACTGCTGCTCGAATACTTCACGTTCCCGGAGAAATTCATGTTCATCGACCTGTTG
GGTCTGGACATGAAAGCGATTCCCGCGTCCATCCGTTCTTTCGATGTCGAAATCGTGCTCGCCAAATCGT
ATCCGGACGACATGCGCTTCACGGAAGAGAACGTGCGGCTGTACTGCACGCCGGTGATCAACCTGTTTCC
GATCGCGGCCGATCCGGTCAATGTCACGCAACTGGAAACGGAGTATCGGGTGCGTGCGCGTGAGCAGTTC
GGATCGCTCGTCGATATCTACTCGGTCGATGCGGTCGAAGGCATCGACGGCGGGCGGCGCTTCGAATATG
TGCCGTTCGCTGCATTCAAGCATCGCGGCGGGATGTTGCGTCACGACCTGCCCGAGCGGTATTTCCACAC
GCGCATGCGACGCGGGCCTTCGGGACGCTTCGATACCTGGGTCGTGCTGGGCGGTCATGCGTGGGAGCAT
GCTCGCGCGCTGCCCAAAGAGAAGTTATCGCTATCGGTGACGGGCACCAACGGCATGTTGCCGCGCAAGG
CGTTGCGAGAAGCGGGCATCACGCGCATGCGCGGCGGCTTCACCAACATCGGCGGAGTACGCAATCTGAC
CGCGCCGACGCTGCCCGTCTATCCGCCGACAGGCGACCGCTTCCAGTGGCGCGTGCTGTCGCATCTCGCG
CCGAACTATCTGTCGCTGCTCGATGCGGAGATGCTGCGCGGCTCGCTCGCGCTCTACGACTGGACCGAAG
GCGAACTGAACCGGCGGCGCATCGAAGCGATCACGGACGTCAAGCATCGTCCGCTCAGCAAGCTCGTCAA
GGGCGGGCTGATGCGCGGCGTGGAAATCACCGTGACGATCGACAGCGGCCGCTTTGCGGGCGATGGCGAT
ATCGATCTGTTCGGCGCCATGCTCAACCGCTTCCTCGGCCTCTACGCGATGCTCAATCTCTACACGAAGC
TCGTGATCGTCTCGCAACCCACGGGCAAGCGCCTCGAATGGCCCGAAACCAAGGGTGAAGGAGCGCCGTT
TTGA