SecReT6
Protein ID: 377807412
SecReT6 ID515
T6SS typeN/A
Gene symbol-
Locus tagBYI23_C000200
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]33214..33978 [+]
Producthypothetical protein
NoteTssJ
UniProt IDG8MIQ3
KEGG IDbyi:BYI23_C000200
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-36, Aligned region: 29..178
T6SS-SciN [PF12790], Evalue: 1.40E-36, Aligned region: 217..236
Protein Sequence: 254 a.a.     [Download]
>gi|377807412|ref|YP_004978604.1| hypothetical protein BYI23_C000200 [Burkholderia sp. YI23]
MNQNDSMKQYQLRGMNKRAAAVAAFAALCALSGCGAWQATKDGTVGAYDWLFTTQVKTMNIDVDARAALN
ETTAGRSLSTVVRFYQLKDTKTFAQLEYVQLQNNDLELLKADLLATKDVVLKPGAAASISEPMDKDAEYV
GVVAFFRSPSSNGVWKLAIPKKQWKDTDPVKVEVRDNTLAYAGAQPKSVKRAAPQQSVPAVAASAASAAS
AVSAATSSVSDVSTTAKTASQSLNSAADSLKSAKASASAVSLPH
 
Nucleotide Sequence: 765 bp     [Download]
>gi|377807392|ref|NC_016590.1|:33214-33978 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAATCAGAACGACAGCATGAAGCAATACCAACTTCGGGGCATGAATAAACGCGCGGCGGCCGTGGCGG
CCTTCGCGGCACTGTGTGCATTATCGGGCTGCGGCGCATGGCAGGCGACCAAGGACGGCACCGTAGGCGC
ATACGACTGGCTCTTCACCACGCAAGTGAAGACCATGAACATCGATGTCGACGCACGTGCGGCATTGAAC
GAAACCACCGCGGGACGTTCGCTCTCGACTGTGGTGCGCTTCTATCAACTGAAGGACACCAAGACCTTCG
CGCAGCTCGAATACGTGCAGCTTCAGAACAATGATCTGGAACTGCTCAAGGCCGATTTGCTGGCCACCAA
GGATGTGGTGCTCAAGCCGGGTGCCGCCGCGAGCATCAGCGAGCCGATGGACAAGGACGCCGAATACGTG
GGCGTCGTGGCGTTCTTTCGCTCACCCAGCAGCAACGGCGTATGGAAGTTGGCGATTCCGAAAAAACAAT
GGAAGGACACCGATCCGGTCAAGGTCGAAGTGCGAGACAACACGCTCGCTTATGCAGGCGCGCAGCCGAA
GTCCGTCAAGCGCGCCGCGCCGCAGCAATCCGTGCCCGCCGTCGCTGCGTCGGCGGCCTCGGCGGCCTCG
GCGGTTTCGGCCGCCACGTCGAGCGTTTCGGATGTCTCGACAACGGCCAAGACGGCATCGCAAAGCCTGA
ATTCCGCCGCCGATTCGCTCAAGAGCGCGAAGGCAAGCGCCAGTGCGGTATCGCTTCCGCATTGA