SecReT6
Protein ID: 377807413
SecReT6 ID515
T6SS typeN/A
Gene symbolompA/motB
Locus tagBYI23_C000210
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]34023..34538 [+]
ProductOmpA/MotB family outer membrane protein
NoteTagL
UniProt IDG8MIQ4, G8MIQ4
KEGG IDbyi:BYI23_C000210
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.10E-22, Aligned region: 56..150
Protein Sequence: 171 a.a.     [Download]
>gi|377807413|ref|YP_004978605.1| OmpA/MotB family outer membrane protein [Burkholderia sp. YI23]
MKNIFSLTACALSITLLSACASAPDRDKETALNQQVGIEVTQTKQGVQVRLPDRVLFDFDKSALRADSGP
ALNRAVVLLKRSKKSVIVEGHTDNTGTHEYNQSLSEARAQTVASALEQRGIVDLRIATKGFAYDKPAASN
DTPEGQAKNRRTEIVVIGESLDAIMGRPSKQ
 
Nucleotide Sequence: 516 bp     [Download]
>gi|377807392|ref|NC_016590.1|:34023-34538 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAAGAATATCTTTTCCCTCACCGCTTGCGCACTGTCGATCACGTTGCTGTCCGCGTGCGCCTCCGCAC
CCGACCGCGACAAGGAAACCGCGCTGAACCAGCAAGTCGGCATCGAGGTCACGCAAACCAAACAAGGCGT
ACAAGTGCGCCTGCCGGATCGCGTGCTGTTCGACTTCGACAAGTCGGCGCTGCGTGCCGATTCGGGCCCG
GCGCTCAACCGTGCGGTCGTGTTGCTCAAGCGCAGCAAGAAGTCGGTGATCGTCGAAGGTCACACGGATA
ATACCGGCACGCATGAGTACAACCAGTCGCTGTCCGAAGCGCGCGCGCAGACGGTCGCGAGTGCGCTGGA
GCAGCGCGGTATCGTCGATTTGCGCATCGCCACGAAGGGCTTCGCTTACGACAAGCCTGCGGCGAGCAAT
GACACGCCCGAAGGTCAGGCGAAGAATCGCCGCACGGAGATCGTCGTGATCGGCGAATCGCTCGATGCAA
TCATGGGCAGGCCGTCGAAACAGTAA