SecReT6
Protein ID: 377807752
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003600
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]414755..415279 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDG8MFY9
KEGG IDbyi:BYI23_C003600
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.40E-60, Aligned region: 10..162
Protein Sequence: 174 a.a.     [Download]
>gi|377807752|ref|YP_004978944.1| type VI secretion protein [Burkholderia sp. YI23]
MAKESSQKFIARNRAPRVQIEYDVEVYGSQKKVNLPFVMGVLSDLSGQPQEDLPPVAERKFLEIDIDNFD
ERLRSMKPRVAMQVDNTLTGEGKIGVDMTFESMDDFEPAAIARKVEPLARLLEARSQLRNLLTYMDGKTD
AEKLVARLLEDPALMSSLTASPKPGEHAETQDTE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|377807392|ref|NC_016590.1|:414755-415279 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGGCCAAAGAGAGCAGTCAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGCAGATCGAGTACGACG
TCGAAGTGTACGGCTCGCAGAAGAAGGTCAATCTTCCTTTCGTGATGGGCGTGCTGTCCGACTTGTCGGG
GCAGCCGCAGGAGGACCTGCCGCCTGTCGCGGAGCGCAAGTTCCTCGAGATCGACATCGACAACTTCGAC
GAACGCCTGCGTTCGATGAAGCCTCGCGTCGCCATGCAGGTCGACAACACGCTGACCGGCGAAGGAAAGA
TCGGCGTCGACATGACCTTCGAGAGCATGGACGACTTCGAGCCCGCCGCGATCGCCCGCAAGGTGGAACC
GCTCGCGAGGCTGCTCGAAGCACGCAGTCAGTTGCGCAACCTGCTGACCTACATGGACGGCAAGACCGAC
GCCGAGAAGCTCGTCGCGCGGCTGCTCGAAGACCCGGCGCTCATGAGTTCGCTGACCGCCTCACCCAAGC
CCGGCGAGCATGCCGAAACCCAGGATACCGAATAA