SecReT6
Protein ID: 377807753
SecReT6 ID517
T6SS typei3
Gene symbolevpB
Locus tagBYI23_C003610
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]415290..416807 [+]
Producttype VI secretion protein, EvpB
NoteTssC
UniProt IDG8MFZ0
KEGG IDbyi:BYI23_C003610
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-189, Aligned region: 74..500
Protein Sequence: 505 a.a.     [Download]
>gi|377807753|ref|YP_004978945.1| type VI secretion protein, EvpB [Burkholderia sp. YI23]
MAETNFDQSVERDRQPAYEAGDASPSGEFQQLLQKAFRPRSDKAREAVESSVRTLAEQALLDTQRVSDDA
LATIEALIARIDEKLSAQINVILHAEPFQKLESAWRGLHYLVSNTESDESLKLRVMNVSKADLHRSLRKY
KGVAWDQSPLFKRLYEEEYGQFGGEPYGALVADYYFDNSGPDVDFLTQIGRVSAAAHAPFIAGADPAVML
MDSWQELANPRDLTKIFQTPEHAAWRSLRDSEDSRYIGLAMPRFLARTPYGAKTSPVDAFDFEEDTAGTD
ASKYAWANAAYAMAANINRSFKTWGWCSRIRGIESGGAVENLPVHAFPTDDGGVDMKCPTEIAISDRREA
ELAKNGFMPLVHRKNSDFAAFIGAQSLNKPIEYEDPDATANANLAARLPYLFACGRFAHYLKCIARDKVG
SFKEKDEMQRWLQDWILQYVDGDPANSSEETKARRPLAAAEVVVEEVEGNPGYYTSKFFLRPHYQLEGLT
VSLRLVSKLPSAKAA
 
Nucleotide Sequence: 1518 bp     [Download]
>gi|377807392|ref|NC_016590.1|:415290-416807 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGGCAGAAACCAACTTCGATCAATCCGTCGAGCGCGATCGGCAACCCGCCTACGAAGCCGGCGACGCAA
GCCCGTCCGGCGAGTTCCAGCAACTCCTGCAGAAGGCGTTCCGTCCTCGCTCGGACAAGGCCCGCGAGGC
GGTCGAAAGCTCGGTGCGTACGCTTGCCGAGCAGGCGCTGCTCGACACGCAGCGCGTGTCCGACGATGCG
CTCGCGACCATCGAAGCGCTGATTGCACGTATCGACGAAAAGCTGAGCGCGCAGATCAACGTGATCCTGC
ATGCGGAGCCTTTTCAGAAGCTCGAAAGCGCATGGCGCGGCCTTCACTACCTCGTCAGCAACACCGAAAG
CGACGAGAGTCTCAAGCTGCGCGTGATGAACGTCTCGAAGGCAGACCTGCATCGTTCGTTGCGCAAGTAC
AAGGGCGTGGCATGGGATCAGAGTCCGCTCTTCAAGCGCCTCTACGAAGAGGAATACGGCCAGTTCGGCG
GCGAGCCGTACGGTGCGCTCGTGGCCGACTATTACTTCGACAACAGCGGCCCCGATGTCGATTTCCTCAC
GCAGATCGGCAGGGTGTCGGCGGCGGCGCACGCACCGTTCATCGCCGGCGCCGATCCCGCCGTCATGCTG
ATGGATTCGTGGCAGGAACTTGCGAACCCGCGCGATCTCACCAAGATCTTTCAGACGCCCGAGCATGCTG
CGTGGCGTTCGCTGCGCGATTCCGAGGACTCGCGCTATATCGGTCTCGCCATGCCGCGCTTTCTCGCGCG
CACGCCCTATGGCGCGAAGACGAGTCCGGTCGACGCGTTCGATTTCGAAGAAGACACGGCGGGCACGGAT
GCCTCGAAATACGCATGGGCGAATGCCGCCTATGCGATGGCCGCCAACATCAACCGCTCGTTCAAGACGT
GGGGATGGTGCTCGCGCATTCGCGGCATCGAGTCCGGTGGCGCGGTCGAGAACCTGCCGGTCCATGCATT
CCCGACCGACGACGGCGGCGTGGACATGAAGTGCCCGACAGAGATCGCCATCAGCGACCGCCGCGAGGCC
GAACTCGCGAAGAACGGTTTCATGCCGCTCGTGCACCGGAAGAACTCCGACTTCGCGGCATTCATCGGTG
CGCAGTCGCTCAACAAGCCGATCGAGTACGAAGACCCCGACGCCACCGCGAACGCGAACCTCGCGGCGCG
TCTGCCGTATCTGTTCGCGTGCGGCCGCTTTGCTCACTACCTGAAGTGCATCGCGCGCGACAAGGTGGGC
AGCTTCAAGGAGAAGGACGAGATGCAGCGCTGGCTGCAGGACTGGATTCTCCAGTACGTGGACGGCGATC
CGGCGAACTCCTCGGAAGAGACCAAGGCGCGCCGGCCGCTGGCGGCAGCGGAAGTCGTCGTCGAGGAAGT
GGAGGGCAATCCGGGCTACTACACGTCCAAGTTCTTCCTGCGGCCGCACTACCAGCTCGAAGGCCTGACG
GTGTCGTTGCGGCTCGTCTCGAAGCTGCCTTCCGCAAAAGCCGCCTGA