SecReT6
Protein ID: 377807754
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003620
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]416858..417349 [+]
Producthypothetical protein
NoteTssD
UniProt IDG8MFZ1
KEGG IDbyi:BYI23_C003620
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.50E-41, Aligned region: 6..137
Protein Sequence: 163 a.a.     [Download]
>gi|377807754|ref|YP_004978946.1| hypothetical protein BYI23_C003620 [Burkholderia sp. YI23]
MAVDIFLKLDTVKGESLDSKHKDEIDVLSWSWGLSQSGTMHLGTGGGGGKVAVQDLTITKYTDRGTPSII
SACATGKHFPTGKLTVRKAGGTKPLEYYTIELEKIIVTNYATGGSDAEDRFTETVTLNFEKFHVTYQQQD
PSTGSAQGGVVESKWNIPANATA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|377807392|ref|NC_016590.1|:416858-417349 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGGCAGTCGATATTTTTCTGAAGCTGGACACGGTCAAGGGCGAATCGCTGGATTCGAAGCACAAGGACG
AGATCGACGTGCTCTCGTGGAGCTGGGGCCTGTCGCAGTCCGGAACCATGCACCTCGGCACGGGCGGCGG
CGGCGGCAAGGTCGCGGTGCAGGACCTGACCATCACGAAATACACCGACCGCGGCACGCCGTCGATCATT
TCCGCCTGCGCCACCGGCAAGCACTTTCCGACCGGCAAGCTCACGGTACGCAAGGCGGGCGGCACCAAGC
CGCTGGAGTACTACACCATCGAGCTCGAAAAGATCATCGTGACGAACTACGCGACCGGAGGCTCGGACGC
CGAGGATCGCTTCACGGAGACGGTGACGCTCAACTTCGAAAAGTTTCACGTGACGTATCAGCAACAGGAC
CCGAGCACCGGGTCCGCGCAGGGCGGCGTGGTGGAGAGCAAGTGGAACATCCCCGCCAACGCGACCGCGT
AA