SecReT6
Protein ID: 377807755
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003630
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]417357..417866 [+]
Producttype VI secretion system lysozyme like protein
NoteTssE
UniProt IDG8MFZ2
KEGG IDbyi:BYI23_C003630
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.10E-16, Aligned region: 36..147
Protein Sequence: 169 a.a.     [Download]
>gi|377807755|ref|YP_004978947.1| type VI secretion system lysozyme like protein [Burkholderia sp. YI23]
MRMRNADRVRPSLLDRLTDHAPGASREGREHRASSARAQRLSVMRDIGWLLNAQGIASAQDIARFPEVAG
SVLNFGFADLAGKSASNVDIGRIERLMSDAIGAFEPRIVPGTLRVRAVQSGDAAIQHNALAFIVEADLHA
HPVPERLYLRTELDLEAGKAKVFEGAIER
 
Nucleotide Sequence: 510 bp     [Download]
>gi|377807392|ref|NC_016590.1|:417357-417866 Burkholderia sp. YI23 chromosome 3, complete sequence
ATCCGCATGAGAAACGCGGACAGAGTGCGGCCGTCGCTGCTCGACCGTCTGACCGATCATGCGCCCGGCG
CATCGCGCGAAGGGCGCGAGCACCGGGCCAGTTCGGCGCGCGCGCAACGCCTGAGCGTGATGCGCGATAT
CGGCTGGCTGCTCAACGCGCAGGGTATCGCGTCGGCGCAGGATATCGCGCGCTTTCCGGAAGTCGCGGGA
TCGGTGCTCAACTTCGGTTTCGCGGACCTGGCCGGCAAGAGCGCGTCGAACGTCGATATCGGACGGATCG
AACGATTGATGAGCGACGCCATCGGCGCGTTCGAGCCGCGCATCGTGCCCGGCACGCTGCGGGTGCGCGC
CGTGCAGTCCGGCGACGCGGCCATTCAGCACAACGCGCTGGCCTTCATCGTGGAGGCGGATCTGCATGCG
CATCCCGTGCCGGAGCGCCTCTATCTGCGCACGGAGCTGGATCTGGAAGCAGGCAAGGCCAAGGTATTCG
AAGGAGCCATCGAGCGATGA