SecReT6
Protein ID: 377807756
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003640
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]417863..419725 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDG8MFZ3
KEGG IDbyi:BYI23_C003640
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-207, Aligned region: 6..616
Protein Sequence: 620 a.a.     [Download]
>gi|377807756|ref|YP_004978948.1| type VI secretion protein [Burkholderia sp. YI23]
MNPDLIQYYSRELQHIREMGGEFAQAFPKIAGRLGLEGFECADPYVERLLEGFGFLAARVQMKIDAEFPR
FTQHLAELVYPHYLAPTPAMTVVHVQPDMTHPALAEGVPVPRGTALHGRLDGERATRCEFRTAHGLTLWP
IELSAARLFTHTGAMPGIEARLPRGVKAGLRLTLRASGGRKLRDLAIDRLPMYLRGNDGVAAKLYELLVG
STLGVVAGDAVLPASALRPLGFSDEEALLPVSEQSFPGYRLLQEYFACPQRFMFIGIEGLRAQLARCDKS
EIELVVLLSRADTALEQVVDQANFALHCTPAINLFPRRADRIAVTGEQFEHHVVVDRTRPRDFEVVRIQG
VTGYRAGGGEIAFQPFYRMRDLGIDEPDAAFYQVRREKRLPSARENERGVRSAARSSYAGSETWIALVDT
RESPYPADLHQLGISVLCTNRDLTLTMPLGRGETDFTLELEAPVAAVRCVAAPSRPLPSYAQGAVAWRLL
SHLSLNHGSLVDDADGSGARAMRDLLALYAPEGDSAAARQIDALRSIRSNAVTRRLPSRGPIVFGRGLAL
DVLLDESGFEGASAFLFGAVLARFFEQYVSLNAFTETIVSSVTRGEIMRWAPESGRCRTL
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|377807392|ref|NC_016590.1|:417863-419725 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAACCCCGACCTCATCCAGTACTACAGCCGCGAATTGCAGCATATCCGCGAAATGGGCGGCGAATTCG
CGCAGGCGTTTCCGAAGATCGCGGGACGGCTGGGCCTCGAAGGCTTCGAATGCGCCGATCCTTACGTCGA
GCGTCTGCTGGAAGGTTTCGGCTTTCTCGCCGCCCGCGTCCAGATGAAGATCGATGCGGAGTTTCCACGC
TTCACGCAGCATCTGGCGGAACTGGTCTATCCGCATTATTTGGCGCCTACGCCGGCGATGACCGTCGTGC
ACGTGCAGCCTGACATGACGCATCCCGCGCTCGCCGAGGGCGTGCCCGTGCCGCGCGGCACCGCCTTGCA
CGGCCGGCTCGACGGTGAACGCGCGACGCGTTGCGAATTCCGCACTGCGCATGGGTTGACGCTGTGGCCC
ATCGAACTGTCGGCGGCGCGGCTCTTCACGCATACCGGCGCGATGCCGGGCATCGAAGCGCGCCTGCCTC
GCGGCGTGAAGGCGGGCCTGCGTCTGACCTTGCGCGCGTCCGGCGGGCGCAAGCTGCGCGACCTCGCGAT
CGATCGTCTGCCCATGTATTTGCGCGGCAACGATGGCGTCGCCGCGAAGCTCTACGAGTTGCTGGTTGGC
TCGACGCTCGGCGTCGTGGCGGGCGATGCGGTGCTGCCGGCCTCCGCGCTGCGCCCGCTCGGTTTCAGCG
ATGAGGAAGCGTTGCTGCCCGTGAGCGAGCAATCGTTTCCGGGATATCGGCTGCTGCAGGAGTATTTCGC
CTGCCCGCAGCGTTTCATGTTCATCGGTATCGAGGGACTGCGTGCTCAACTGGCGCGCTGCGACAAGAGC
GAGATCGAGCTGGTCGTGCTGCTGTCGCGCGCGGACACCGCGCTGGAACAGGTCGTCGATCAGGCGAATT
TCGCGCTGCATTGCACGCCCGCGATCAATCTGTTCCCGCGCCGCGCCGATCGCATTGCCGTGACGGGCGA
GCAGTTCGAACATCACGTGGTCGTCGATCGCACGCGGCCCCGCGATTTCGAGGTGGTCCGCATTCAGGGC
GTGACGGGATATCGTGCGGGCGGCGGCGAGATCGCATTCCAGCCGTTCTACCGCATGCGCGATCTCGGTA
TCGACGAGCCCGATGCCGCGTTCTATCAGGTGCGTCGCGAGAAGCGTCTGCCGTCGGCGCGCGAGAACGA
GCGCGGCGTCCGGTCTGCCGCGCGTTCCTCCTATGCGGGCAGCGAAACGTGGATTGCGCTCGTGGACACG
CGCGAGTCGCCTTATCCCGCCGATCTTCATCAGCTCGGCATCAGCGTGCTGTGCACCAACCGCGATCTCA
CGCTGACCATGCCCCTCGGACGCGGCGAGACCGACTTCACGCTGGAACTCGAAGCGCCCGTCGCGGCCGT
GCGCTGCGTGGCCGCGCCGAGCCGTCCGTTGCCTTCATACGCGCAGGGCGCGGTCGCGTGGCGGCTGCTG
AGCCATCTGTCGCTGAACCACGGCTCCCTCGTGGACGATGCCGACGGCAGCGGCGCACGCGCCATGCGCG
ATCTGCTCGCGCTCTACGCACCCGAAGGCGACAGCGCGGCCGCGCGTCAGATCGATGCACTGCGCTCGAT
TCGCTCGAACGCGGTCACGCGCCGGTTGCCCTCGCGCGGCCCGATCGTATTCGGGCGCGGCCTCGCACTC
GACGTGCTGCTCGACGAGAGCGGATTCGAAGGCGCGAGCGCGTTTCTGTTCGGCGCGGTGCTCGCGCGCT
TCTTCGAGCAATACGTCTCGTTGAACGCCTTCACGGAAACCATCGTGTCGTCGGTGACGCGCGGTGAAAT
CATGCGCTGGGCGCCGGAGAGCGGACGATGCCGGACGCTGTGA