SecReT6
Protein ID: 377807757
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003650
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]419710..420726 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDG8MFZ4
KEGG IDbyi:BYI23_C003650
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.00E-114, Aligned region: 13..315
Protein Sequence: 338 a.a.     [Download]
>gi|377807757|ref|YP_004978949.1| type VI secretion protein [Burkholderia sp. YI23]
MPDAVTLFERFAADANRFDFFQAVRLIDAAHPAWPRTGASLRPRDDAVRFGQEPELIFFPTTLKHFVGMQ
AQPPRLAVNFFGLLGPNGPMPTHLTEYVRDRARNAGDPTFARFLDVFHHRMTSLFYRAWAAAQPVVSLDR
RDDDRFSSYVGTVFGLNQPSLRNRDSVHDFAKLHFAGLLAGPTRHAAGLRLVLSRYFGLPVQVTQNVGHW
LKLPDEARSRLGAPDDGARMGVGTMLGARVFDRQHKFRIVLGPLSLHDYARFLPDGASLVRLVDWVRFYV
RDPLEWDVNLQLRRADVPRLALGRHQRLGYTTWLHARAPSRDATQLMLRPLASSHAKD
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|377807392|ref|NC_016590.1|:419710-420726 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGCCGGACGCTGTGACCTTGTTCGAACGCTTCGCCGCCGATGCGAACCGCTTCGATTTTTTTCAGGCCG
TCAGGCTCATCGACGCGGCGCATCCGGCCTGGCCGCGCACCGGCGCGTCCCTGCGTCCGCGCGACGATGC
GGTGCGCTTCGGCCAGGAACCGGAGTTGATCTTCTTTCCGACCACGCTGAAGCACTTCGTCGGCATGCAG
GCGCAGCCGCCCAGGCTCGCCGTCAACTTTTTCGGACTGCTCGGACCGAACGGCCCGATGCCCACGCATC
TGACCGAATACGTGCGCGATCGCGCGCGCAATGCGGGCGATCCGACCTTTGCGCGCTTTCTCGATGTGTT
TCATCACCGCATGACGTCGCTGTTCTATCGCGCATGGGCGGCCGCGCAGCCGGTCGTCAGTCTGGATCGC
CGCGACGACGACCGCTTTTCGTCCTATGTCGGCACGGTGTTCGGGCTCAATCAGCCATCGCTGCGCAATC
GCGACTCGGTGCACGATTTCGCCAAACTGCATTTCGCCGGGCTGCTGGCGGGCCCGACGCGCCATGCCGC
CGGCTTGCGGCTGGTGCTGTCACGTTACTTCGGTCTGCCGGTGCAGGTGACGCAGAACGTCGGTCACTGG
CTGAAGTTGCCAGACGAGGCACGCTCGCGCCTCGGCGCGCCCGACGATGGCGCGCGCATGGGCGTCGGCA
CGATGCTCGGGGCGCGCGTGTTCGATCGCCAGCACAAGTTCCGCATCGTGCTCGGCCCGCTTTCGCTGCA
CGACTACGCGCGTTTTCTGCCGGATGGCGCGAGCCTTGTGCGCCTGGTCGACTGGGTGCGCTTCTATGTG
CGCGACCCGCTCGAATGGGACGTGAATCTGCAATTGCGGCGCGCGGACGTCCCGCGTCTCGCGCTCGGGC
GGCATCAGCGCCTCGGCTACACGACGTGGCTGCATGCGCGCGCGCCGAGCCGCGACGCGACGCAACTCAT
GCTTCGGCCGCTCGCCTCATCTCATGCAAAGGACTAG