SecReT6
Protein ID: 377807758
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003660
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]420731..423340 [+]
Productchaperone
NoteTssH
UniProt IDG8MFZ5
KEGG IDbyi:BYI23_C003660
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.10E-38, Aligned region: 225..254
AAA_2 [PF07724], Evalue: 2.10E-38, Aligned region: 601..767
AAA [PF00004], Evalue: 1.60E-18, Aligned region: 225..358
AAA [PF00004], Evalue: 1.60E-18, Aligned region: 607..691
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 225..303
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 329..355
AAA_5 [PF07728], Evalue: 1.40E-13, Aligned region: 606..723
ClpB_D2-small [PF10431], Evalue: 4.00E-12, Aligned region: 774..847
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 36..78
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 125..186
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 202..244
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 270..303
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 340..482
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 601..645
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 672..694
AAA_16 [PF13191], Evalue: 1.30E-10, Aligned region: 750..788
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 224..338
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 354..401
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 605..629
AAA_22 [PF13401], Evalue: 2.10E-09, Aligned region: 668..693
Sigma54_activat [PF00158], Evalue: 6.10E-07, Aligned region: 203..240
Sigma54_activat [PF00158], Evalue: 6.10E-07, Aligned region: 606..706
AAA_25 [PF13481], Evalue: 1.10E-06, Aligned region: 220..333
AAA_25 [PF13481], Evalue: 1.10E-06, Aligned region: 602..634
AAA_25 [PF13481], Evalue: 1.10E-06, Aligned region: 775..815
AAA_17 [PF13207], Evalue: 1.00E-05, Aligned region: 225..270
AAA_17 [PF13207], Evalue: 1.00E-05, Aligned region: 606..644
Arch_ATPase [PF01637], Evalue: 2.60E-05, Aligned region: 203..238
Arch_ATPase [PF01637], Evalue: 2.60E-05, Aligned region: 278..379
Arch_ATPase [PF01637], Evalue: 2.60E-05, Aligned region: 606..649
AAA_19 [PF13245], Evalue: 4.20E-05, Aligned region: 225..247
AAA_19 [PF13245], Evalue: 4.20E-05, Aligned region: 369..402
AAA_19 [PF13245], Evalue: 4.20E-05, Aligned region: 604..628
AAA_18 [PF13238], Evalue: 5.90E-05, Aligned region: 225..245
AAA_18 [PF13238], Evalue: 5.90E-05, Aligned region: 607..638
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 225..241
Zeta_toxin [PF06414], Evalue: 0.0001, Aligned region: 601..656
IstB_IS21 [PF01695], Evalue: 0.0003, Aligned region: 218..262
IstB_IS21 [PF01695], Evalue: 0.0003, Aligned region: 606..626
AAA_14 [PF13173], Evalue: 0.00031, Aligned region: 225..326
AAA_14 [PF13173], Evalue: 0.00031, Aligned region: 605..687
AAA_29 [PF13555], Evalue: 0.0004, Aligned region: 217..242
AAA_29 [PF13555], Evalue: 0.0004, Aligned region: 604..631
NACHT [PF05729], Evalue: 0.0007, Aligned region: 225..253
NACHT [PF05729], Evalue: 0.0007, Aligned region: 606..633
Clp_N [PF02861], Evalue: 0.00086, Aligned region: 28..75
Clp_N [PF02861], Evalue: 0.00086, Aligned region: 112..133
Torsin [PF06309], Evalue: 0.0011, Aligned region: 563..629
T2SE [PF00437], Evalue: 0.0015, Aligned region: 198..241
T2SE [PF00437], Evalue: 0.0015, Aligned region: 602..683
Hpr_kinase_C [PF07475], Evalue: 0.0054, Aligned region: 225..237
Hpr_kinase_C [PF07475], Evalue: 0.0054, Aligned region: 603..624
Protein Sequence: 869 a.a.     [Download]
>gi|377807758|ref|YP_004978950.1| chaperone [Burkholderia sp. YI23]
MADISRAVMFGKLDTLSFRAMESATTFCRLRGNPYVEVVHWLHQVLQLPDSDLHRVIRHADIDPAVLARD
LTDALDRLPRGASSVTDIGAQLEEAVERGWVHASLMFEAHTIRSVHVLVGMLRTPALRNVLRGISREFDR
VKADELVERHADLFDGSPETQAQTAPAPQPPADAGAPRTNDALQRFTVDLTEDARSGKLDPIVGRDEEIR
QVVDILMRRRQNNPILTGEAGVGKTAVVEGLALRIVAGDVPPALRHVSLRTLDVALLQAGAGMKGEFETR
LRQVLDAVQSAEKPVILFIDEAHTLIGAGGAAGTGDAANLLKPALARGAVRMIAATTWSEYRRHIEKDPA
LTRRFQVVQVHEPDETRAVTMMRGIAAALEAHHGVQILDEAVEAAVRLSHRYLPARQLPDKSVSLLDTAC
ARVAVSQHATPPAVDDARRRIETLMTELDVIAREAAIGIDTATRHEAASADLQLANAHLAALEARWHAER
GMVEDILARRRALREHAPDTDLNALRERQAQLALHQGEAPLILPGVDRHAVAAVVQDWTGVPVLNMLKNE
VGNVLRLDELLDRRIIGQHHATRMIARRVQTSRAGLDDPNKPVGVFLLAGTSGVGKTETALALAEALYGG
EQNLITINMSEYQEAHTVSLLKGAPPGYVGFGEGGVLTEAVRRRPHSVVLLDEVEKAHPDVHELFFQVFD
KGRMDDSEGRSIDFRNTLILLTTNAGTDCIAELCTGPRAPAPMEVIERELHAQLLQTFPPALLGRMVTIP
YYPLSGDMLRAIIRLQLGRVAERVTSTHRVPFTYDDDVVAQIALRCTRLESGGRMIDAILTNSVLPRIST
EYLSRVMAGTALSRVHVGVEDEEFTYAFD
 
Nucleotide Sequence: 2610 bp     [Download]
>gi|377807392|ref|NC_016590.1|:420731-423340 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGGCAGACATCAGCCGTGCCGTCATGTTCGGCAAACTCGACACGCTCAGCTTCCGCGCGATGGAAAGCG
CCACGACGTTCTGCCGTCTGCGCGGCAATCCGTATGTGGAGGTTGTGCACTGGCTGCATCAGGTACTGCA
GTTGCCGGATTCCGATCTGCATCGCGTGATCCGCCATGCGGACATCGATCCAGCGGTGCTCGCGCGCGAT
CTGACCGATGCGCTGGACCGTCTGCCGCGCGGCGCATCGTCGGTGACGGATATCGGCGCACAACTCGAAG
AAGCGGTGGAGCGCGGCTGGGTGCATGCATCGCTGATGTTCGAGGCGCACACGATACGCAGCGTGCATGT
GCTCGTCGGCATGTTGCGGACGCCCGCGCTGCGCAACGTGTTGCGCGGCATCTCGCGCGAGTTCGACCGC
GTGAAGGCGGACGAACTCGTCGAGCGCCATGCCGATCTCTTCGACGGCTCGCCCGAAACGCAGGCGCAGA
CAGCGCCCGCGCCGCAGCCGCCGGCGGACGCGGGCGCGCCTCGGACGAACGACGCGCTGCAACGCTTCAC
CGTCGATCTGACCGAGGACGCGCGCTCGGGCAAGCTCGATCCGATCGTCGGCCGGGACGAGGAAATCCGC
CAGGTCGTCGACATTCTCATGCGCCGCCGCCAGAACAACCCGATTCTCACGGGCGAGGCCGGCGTCGGCA
AGACGGCGGTCGTGGAAGGGCTTGCGTTGCGCATCGTCGCGGGCGATGTGCCGCCCGCCTTGCGGCACGT
GAGCCTGCGCACGCTCGACGTGGCATTGCTGCAGGCGGGCGCGGGCATGAAAGGCGAGTTCGAGACGCGT
CTGCGTCAGGTGCTGGATGCGGTGCAGTCCGCGGAGAAGCCGGTGATCCTCTTCATCGACGAGGCGCACA
CGCTGATCGGCGCGGGCGGGGCGGCGGGCACCGGTGACGCGGCGAATCTGCTCAAGCCGGCGCTGGCACG
CGGCGCCGTGCGCATGATCGCGGCCACGACGTGGTCCGAATACCGGCGGCACATCGAGAAGGACCCCGCC
CTCACGCGGCGTTTTCAGGTCGTGCAGGTGCATGAGCCCGACGAGACGCGCGCGGTGACGATGATGCGCG
GCATCGCCGCTGCGCTCGAGGCGCATCACGGCGTGCAGATCCTGGACGAAGCCGTCGAGGCGGCGGTGAG
GCTTTCGCATCGCTATCTGCCGGCGCGCCAGTTGCCCGACAAGTCGGTGAGCCTGCTCGACACCGCCTGC
GCGCGGGTCGCCGTGAGCCAGCATGCGACACCGCCCGCCGTCGACGATGCAAGGCGGCGCATCGAGACGC
TCATGACCGAACTCGACGTCATCGCGCGCGAGGCCGCCATCGGCATCGATACCGCGACACGGCACGAAGC
GGCATCCGCGGACCTGCAGCTTGCCAACGCGCATCTGGCGGCCCTCGAAGCGCGCTGGCACGCCGAGCGC
GGCATGGTCGAGGACATCCTCGCGCGCCGCCGCGCGTTGCGCGAACACGCGCCCGACACCGATCTGAACG
CGCTGCGCGAACGTCAGGCGCAACTCGCCCTGCATCAGGGCGAAGCGCCGCTGATCCTGCCCGGCGTGGA
TCGTCACGCGGTCGCGGCGGTCGTTCAGGACTGGACCGGCGTGCCCGTGCTCAACATGCTGAAGAACGAG
GTCGGCAATGTCCTGCGTCTCGACGAACTGCTCGACAGGCGCATCATCGGGCAGCACCACGCCACGCGCA
TGATCGCGCGCCGCGTGCAGACCTCGCGCGCGGGCCTCGACGATCCGAACAAGCCCGTCGGCGTGTTTCT
GCTGGCCGGAACCTCGGGCGTCGGCAAGACGGAGACGGCGCTCGCGCTCGCGGAGGCGCTCTATGGCGGC
GAGCAGAATCTCATCACCATCAACATGAGCGAGTATCAGGAGGCGCATACCGTGTCGCTCCTGAAGGGCG
CGCCGCCGGGCTATGTCGGATTCGGCGAGGGTGGCGTGCTGACCGAGGCGGTGCGCCGCCGTCCGCATAG
TGTCGTGCTGCTCGACGAAGTCGAGAAGGCCCATCCGGATGTGCACGAACTGTTCTTCCAGGTCTTCGAC
AAGGGCCGCATGGACGACAGCGAAGGGCGTTCCATCGATTTCCGCAACACGCTGATCCTGCTGACCACCA
ACGCGGGCACCGACTGTATCGCGGAACTGTGCACCGGCCCGCGGGCGCCCGCGCCGATGGAGGTGATCGA
GCGGGAACTGCATGCGCAACTGCTGCAGACGTTTCCGCCCGCGCTGCTCGGGCGCATGGTGACGATTCCG
TATTACCCGCTTTCCGGCGACATGCTGCGCGCGATCATCCGGCTGCAACTCGGGCGCGTGGCGGAGCGGG
TGACGAGCACGCATCGTGTGCCGTTCACTTACGACGATGACGTCGTCGCGCAGATCGCGCTGCGCTGTAC
GCGGCTGGAAAGCGGCGGCCGCATGATCGACGCGATCCTCACCAACAGCGTGCTGCCGCGCATCAGTACG
GAGTATCTGTCGCGCGTGATGGCGGGCACGGCCCTTTCGCGCGTGCATGTGGGCGTCGAGGACGAGGAGT
TCACGTATGCCTTCGACTGA