SecReT6
Protein ID: 377807759
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003670
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]423327..425300 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDG8MFZ6
KEGG IDbyi:BYI23_C003670
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-70, Aligned region: 28..329
Phage_base_V [PF04717], Evalue: 8.80E-26, Aligned region: 200..215
Phage_base_V [PF04717], Evalue: 8.80E-26, Aligned region: 298..316
Phage_base_V [PF04717], Evalue: 8.80E-26, Aligned region: 374..470
Protein Sequence: 657 a.a.     [Download]
>gi|377807759|ref|YP_004978951.1| ImpA family type VI secretion-associated protein [Burkholderia sp. YI23]
MPSTERHVRLNCAALGGDAVFLRMSASEALGRLSRYEIVFLSMRNDIDPGKVLGQDLTVTLDYPAGGARE
FNGIVTTLRLLIPGDSTKNRMARYEAIVHPRMWLLTRAAHRRFYHQRTVPQIVSKVLESYDVDFRNACTA
SYPPLDHCVQHRETDFDFVSRLMEREGIHYFFEHEGGKHTLVLADSGAEHRPIAHYGTVPFQAWDTPRQD
EECVYRWVSGATLETGRYEVNDYDFEKASVSNSEGLVARATRGAPYDPPRYLMQEHLTGHLSAGDGERLA
RVNVEIHQTQNDSIEGRSTARGIAAGGLFRLRDHPAGAQNRQYLVIENHAEIVSDAYVSSDDPSRPLFDC
RFRAIRGDTTFRSPRVTPAPRVAGPQTAVVIGPPGEEILTDQYGRVKVRFHWEQLTQTDGANPLDRCWVR
VAQGWANRRWGAMFLPRIGQEVLVEFVEGDPDRPVITGAAYNSTNMPPYELPAQSAVSTLKSQSTKGGNG
YNEVRFDDRKGSEQMFFHAERDHETWIKNDALMNVSGERHVSIGGDEFRATRGARNDSVTGRSTSRVLGG
VSAASMTTHDQFVGEAYSLEAGSTVRIKAGAAVEVEASATIALRAGASYILIGPETIEMSSFPIPIGPGV
PPVPLAIPPAPPAPPRDADDGASKGRK
 
Nucleotide Sequence: 1974 bp     [Download]
>gi|377807392|ref|NC_016590.1|:423327-425300 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGCCTTCGACTGAACGCCATGTGCGGCTGAATTGCGCGGCGCTCGGCGGCGATGCCGTGTTCCTGCGCA
TGTCCGCCAGCGAAGCGCTCGGGCGTCTGAGCCGTTACGAGATCGTTTTTCTTTCGATGCGCAACGACAT
CGATCCGGGCAAGGTGCTCGGGCAGGACCTCACGGTGACGCTCGACTATCCGGCCGGCGGCGCGCGCGAG
TTCAACGGCATCGTGACGACGCTGCGTCTCCTGATTCCCGGCGACAGCACGAAGAACCGCATGGCGCGCT
ACGAAGCGATCGTGCATCCGCGCATGTGGCTGCTCACGCGCGCCGCGCACCGGCGCTTCTACCATCAGCG
CACGGTGCCGCAGATCGTGTCGAAGGTGCTCGAATCGTACGACGTCGATTTTCGCAACGCGTGCACGGCG
AGTTATCCGCCGCTCGATCATTGCGTGCAGCACCGCGAAACGGATTTCGATTTCGTCAGCCGCCTGATGG
AACGCGAAGGCATTCACTACTTCTTCGAGCACGAAGGCGGCAAACACACGCTCGTGCTCGCGGACTCCGG
CGCCGAACACCGGCCCATCGCGCATTACGGCACGGTGCCGTTTCAGGCGTGGGACACGCCACGGCAGGAC
GAGGAGTGCGTGTATCGCTGGGTATCGGGCGCGACGCTGGAAACGGGGCGCTACGAAGTCAACGATTACG
ACTTCGAGAAAGCCTCCGTCAGCAACAGCGAAGGGCTCGTCGCCCGGGCCACGCGCGGCGCGCCGTATGA
CCCGCCGCGCTATCTGATGCAGGAGCATCTGACCGGGCATCTGTCGGCGGGCGACGGCGAGCGGCTTGCG
CGCGTGAACGTCGAGATCCATCAGACGCAGAACGATTCGATCGAAGGGCGCAGCACCGCGCGCGGCATCG
CGGCGGGCGGGCTGTTCCGTCTTCGCGATCATCCGGCGGGCGCGCAGAACCGGCAGTATCTGGTGATCGA
AAACCACGCGGAGATCGTGTCGGATGCCTATGTATCGTCCGACGATCCGAGCCGGCCGCTCTTCGATTGC
CGCTTCCGGGCGATCCGCGGCGACACCACGTTCCGCTCGCCGCGCGTGACGCCCGCGCCGCGCGTCGCCG
GCCCGCAGACCGCCGTGGTGATCGGGCCGCCGGGAGAGGAGATTCTCACGGATCAATACGGCCGCGTGAA
AGTGCGGTTCCACTGGGAACAACTCACGCAGACCGACGGCGCAAACCCGCTCGACCGCTGCTGGGTGCGC
GTCGCGCAAGGCTGGGCCAACCGGCGCTGGGGCGCGATGTTCCTACCGCGCATCGGGCAGGAAGTGCTCG
TCGAGTTCGTCGAAGGCGACCCGGACAGGCCGGTGATCACGGGCGCGGCCTACAACTCGACCAACATGCC
GCCGTATGAACTGCCCGCGCAAAGCGCCGTCTCCACCCTGAAGAGCCAGTCGACCAAAGGCGGCAACGGC
TACAACGAAGTCCGTTTCGACGATCGCAAGGGCAGCGAGCAGATGTTCTTTCATGCCGAGCGCGATCACG
AAACCTGGATCAAGAACGACGCGCTGATGAACGTATCGGGCGAGCGCCACGTGAGCATCGGCGGCGACGA
GTTCCGCGCGACGCGCGGCGCGCGCAACGATTCCGTCACGGGGCGAAGCACGTCGCGCGTGCTCGGCGGC
GTGTCGGCGGCGAGCATGACGACGCACGACCAGTTCGTCGGCGAGGCGTATTCGCTGGAGGCGGGCTCGA
CGGTGCGCATCAAGGCGGGCGCGGCGGTGGAAGTCGAGGCGAGCGCGACCATCGCATTGCGCGCCGGCGC
GTCGTACATCCTCATCGGTCCCGAGACGATCGAGATGTCGAGCTTTCCGATTCCGATCGGCCCAGGCGTG
CCGCCGGTGCCGCTCGCCATTCCGCCCGCGCCGCCGGCGCCGCCGCGCGATGCCGACGATGGCGCCAGCA
AGGGCCGCAAATAG