SecReT6
Protein ID: 377807760
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003680
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]425310..426689 [+]
Productregulatory protein
NoteFha
UniProt IDG8MFZ7
KEGG IDbyi:BYI23_C003680
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 4.20E-12, Aligned region: 28..94
Protein Sequence: 459 a.a.     [Download]
>gi|377807760|ref|YP_004978952.1| regulatory protein [Burkholderia sp. YI23]
MTLTLTVRGGESDERAAPHTMAIDEAATIGRAPDCTLVLGDTQRGISRIQARIERRGDTYVLVDAGSNPT
LLNDKALGAEREAVLSNDDRIGIGAYTLVVSVETVFAVDQTLMTQATPSAPVPSAGLPATPEFEAPPPAP
LIPDDWNAPHDRTASHAGPGDDDAPFTPDPLAATPLLREPGNFGGDASQALMDALSGADPLRDAGAPRAP
RVAAAVRSLEHVSPERVMSALPAMQPPSQPDAVPPAEERQMRDAPPSASKDDEAALLDALLDGLGVEHAD
VAHIAAPDLARLIGSMLRTATQGAMSVLRSRAMTKRETRMAMTMIEERDNNPLKFFPDADRALTQMLGAR
GRGYLAPDEAMRAAFHDIQTHELALIAGMRAALDDAMARIEPAAIERSLDAPDRFHAIVGNRKARLWQRY
VKTWERVSRDTGDDFQQRFGEPFGRAYQAQLDALQSPKD
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|377807392|ref|NC_016590.1|:425310-426689 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGACACTGACGCTGACAGTGCGAGGCGGCGAAAGCGACGAGCGCGCCGCGCCGCATACGATGGCAATCG
ACGAGGCCGCCACCATCGGGCGCGCGCCGGACTGCACGCTGGTGCTGGGAGACACGCAGCGCGGCATCTC
GCGCATTCAGGCGCGCATCGAACGCCGAGGCGACACCTACGTTCTGGTCGATGCCGGCAGCAATCCGACG
CTCCTGAACGACAAAGCGCTCGGGGCCGAGCGCGAGGCGGTCCTGTCGAACGACGACCGTATCGGGATCG
GGGCTTATACGCTGGTCGTGTCGGTCGAAACGGTGTTCGCCGTCGACCAGACCCTGATGACGCAGGCCAC
ACCGTCCGCGCCGGTTCCGTCCGCGGGCCTGCCGGCCACGCCGGAATTCGAGGCGCCGCCGCCCGCGCCG
CTCATTCCCGACGACTGGAACGCGCCGCACGACCGCACCGCGTCTCACGCCGGGCCGGGCGACGACGATG
CCCCCTTTACCCCCGACCCGCTTGCCGCGACGCCGCTCTTGCGCGAACCCGGCAATTTCGGCGGCGATGC
GAGTCAGGCCCTGATGGATGCGCTGAGCGGCGCCGATCCGCTGCGCGATGCGGGCGCGCCGCGCGCTCCA
CGGGTGGCGGCGGCGGTGCGGAGTCTGGAGCACGTCTCGCCGGAGCGCGTCATGTCGGCGTTGCCCGCTA
TGCAACCGCCTTCGCAACCGGATGCGGTACCGCCAGCCGAAGAACGGCAGATGCGCGATGCGCCGCCATC
TGCATCGAAAGACGACGAAGCGGCGCTGCTCGATGCCTTGCTCGACGGCCTCGGCGTCGAACATGCCGAC
GTCGCGCACATCGCCGCGCCGGACCTCGCGCGCCTGATCGGATCGATGTTGCGCACGGCCACGCAGGGCG
CGATGTCCGTCCTTCGTTCGCGGGCGATGACCAAGCGCGAAACCCGCATGGCCATGACGATGATCGAGGA
GCGCGACAACAATCCGCTCAAGTTCTTCCCGGACGCCGATCGCGCGCTGACGCAGATGCTCGGCGCGCGG
GGCCGCGGCTACCTTGCGCCCGACGAAGCCATGCGCGCCGCGTTCCACGACATCCAGACGCACGAACTGG
CGCTCATCGCCGGCATGCGCGCCGCGCTCGACGACGCCATGGCGCGCATCGAACCGGCCGCCATCGAACG
TTCGCTCGATGCGCCGGACCGGTTCCACGCCATCGTCGGCAATCGCAAGGCGCGTCTGTGGCAGCGCTAC
GTCAAGACCTGGGAACGCGTGTCGCGCGATACCGGCGACGACTTTCAGCAGCGCTTCGGCGAGCCGTTCG
GCCGTGCGTATCAGGCGCAGCTCGATGCGCTGCAATCCCCGAAAGACTGA