SecReT6
Protein ID: 377807761
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003690
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]426698..428032 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDG8MFZ8
KEGG IDbyi:BYI23_C003690
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.90E-151, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|377807761|ref|YP_004978953.1| type VI secretion protein [Burkholderia sp. YI23]
MYWNNKVIWSEGMFLQPQHLQQHDRHVEALLEGRAGALRPYAWGFTKLEIDEALLKLGKLALRSAAGVLP
DGTPFSLPADDDLPEPLDIPENAANVTVMLALPVRRPGSPESGGDEHADNLARYRAGDVEVHDSNEADAL
ATLLQVGKLRLRLALSPDVAHAHACAGVAHVIERKSDGRVVLDDEYCAPCLDYRVAGKLARFATELAGLL
QQRGEALAGRLAQPDGAGMAEIADFLLLQIVNRAQPLVAHFNALSGLHPEALYRVCIGLAGELATFSQTG
RRPPEFPAYRHERLKESFEPVIAALRLALSRVADPQVVSIALEERRYGLRVALVNDRALFTGATFVLAAR
AQVPTDTLLSGFGSQVKIGSIEKIRDLVNLQLPGIALRALAVAPRQLPFHAGYSYFELDDKNEAWATLAS
SAGMALHVAGEFPGLAMELWAIRH
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|377807392|ref|NC_016590.1|:426698-428032 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGTACTGGAACAACAAGGTCATCTGGTCGGAGGGCATGTTCCTCCAGCCGCAGCATCTGCAGCAGCACG
ACCGTCATGTCGAGGCGCTGCTCGAAGGCCGCGCCGGCGCGCTGCGTCCGTATGCGTGGGGCTTCACGAA
ACTCGAAATCGACGAGGCGCTGCTCAAGCTCGGCAAGCTCGCGCTCCGGTCCGCGGCCGGCGTGCTGCCG
GACGGCACGCCCTTCAGCCTGCCCGCCGACGACGACCTGCCCGAGCCGCTCGATATTCCCGAGAACGCGG
CGAACGTGACGGTCATGCTCGCCTTGCCGGTGCGACGGCCCGGCTCGCCGGAATCGGGCGGCGACGAGCA
CGCGGACAATCTCGCGCGTTATCGCGCAGGCGATGTCGAAGTTCACGACAGCAACGAAGCCGATGCGCTC
GCCACGCTGCTGCAGGTGGGCAAGCTGCGTCTGCGCCTCGCGCTCTCGCCCGACGTCGCGCATGCCCATG
CGTGCGCCGGGGTCGCGCATGTGATCGAACGCAAGAGCGACGGCCGCGTGGTGCTCGACGACGAATACTG
CGCGCCCTGTCTCGACTATCGCGTGGCGGGCAAGCTCGCGCGCTTTGCGACGGAGCTCGCCGGCCTGCTG
CAACAGCGCGGCGAAGCGCTTGCGGGACGGCTCGCGCAGCCCGATGGCGCGGGCATGGCCGAGATCGCCG
ATTTCCTGCTGCTGCAGATCGTCAACCGGGCGCAGCCGCTCGTCGCGCATTTCAACGCGCTGAGCGGGCT
GCATCCCGAGGCGCTTTATCGGGTGTGCATCGGCCTCGCGGGGGAACTCGCCACGTTCAGTCAGACGGGC
CGCAGACCGCCGGAATTTCCCGCGTACCGGCACGAACGGCTGAAGGAGAGCTTCGAGCCGGTGATCGCCG
CGCTGCGCCTCGCCTTGTCGCGCGTGGCCGATCCGCAGGTCGTGTCCATTGCGCTGGAGGAGCGCCGCTA
CGGCCTGCGCGTCGCGCTGGTCAACGATCGCGCGCTCTTCACCGGGGCGACTTTCGTGCTGGCGGCGCGC
GCTCAGGTGCCGACCGACACGCTGCTGTCCGGGTTCGGCAGCCAGGTGAAGATCGGCAGTATCGAAAAGA
TCCGCGACCTCGTGAATCTGCAATTGCCCGGCATTGCGCTGCGCGCGCTCGCGGTCGCGCCGCGCCAGTT
GCCGTTCCACGCCGGCTACAGCTACTTCGAACTCGACGACAAGAACGAAGCATGGGCGACGCTGGCGTCC
TCCGCCGGCATGGCGCTGCACGTCGCGGGCGAATTCCCCGGCCTCGCGATGGAACTCTGGGCGATCCGGC
ACTGA