SecReT6
Protein ID: 377807762
SecReT6 ID517
T6SS typei3
Gene symboldotU
Locus tagBYI23_C003700
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]428061..429395 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDG8MFZ9
KEGG IDbyi:BYI23_C003700
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 8.00E-63, Aligned region: 58..258
OmpA [PF00691], Evalue: 6.80E-17, Aligned region: 334..431
RskA [PF10099], Evalue: 0.007, Aligned region: 200..325
Protein Sequence: 444 a.a.     [Download]
>gi|377807762|ref|YP_004978954.1| DotU family type IV/VI secretion system protein [Burkholderia sp. YI23]
MSNDTHPPLDDAVFLDAAQTIRMPTPGRKREPATNAGAPPATTEAPLAPLDASIAGRNPLLRAASPLLEL
ALPLRRLASHPDLEALRAQLIQMVRRFEADGRSFGVPDAQLGPARYCLCTFIDEAIAATPWGAGVWGRRS
LLVTFHNEASGGERLFVILQRLAQTPAVDIDMLELIYVMLALGFDGRYRLIEGGKRQLDDIRARLEQMIR
AQRGAVERALSPHWRPADRERKRLLGFLPLWVALALAAAVLMTAGLVLGLRINAFSDPVFAAMRAIRVAP
APVLADKTKAAPKLAAALSGFLAPEIAQGLVTVGESADRTTVTLNNTAQGVQIFASGSADLDAHFAPLVQ
RIGEALRDKPGNVVVIGHTDNQRIVSARFPSNVALSQARADKVRAMLAAKLPDPARVSAEGRGDTEPVAS
NDTAAGRARNRRVSIDILSPGAAP
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|377807392|ref|NC_016590.1|:428061-429395 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGTCCAACGACACCCACCCGCCGCTCGACGACGCGGTGTTTCTCGACGCGGCCCAGACCATCCGGATGC
CGACGCCCGGCCGCAAGCGCGAGCCCGCGACGAACGCCGGCGCGCCGCCCGCGACGACCGAAGCGCCGCT
CGCGCCGCTCGACGCCTCGATCGCGGGGCGCAATCCGCTCCTGCGCGCGGCGAGTCCGCTGCTCGAACTC
GCGCTGCCGCTGCGCCGGCTCGCGAGCCACCCCGATCTCGAAGCCCTGCGCGCGCAGTTGATTCAGATGG
TGCGCAGGTTCGAAGCCGATGGCCGCTCGTTCGGCGTGCCCGATGCCCAACTCGGACCGGCCCGCTATTG
CCTGTGCACGTTCATCGACGAAGCCATTGCCGCCACGCCGTGGGGTGCGGGCGTGTGGGGCCGCCGCAGT
CTGCTCGTGACGTTTCACAACGAGGCATCGGGCGGCGAGCGGCTGTTCGTCATCCTGCAACGGCTGGCGC
AAACCCCGGCGGTGGATATCGACATGCTCGAACTCATCTACGTGATGCTCGCGCTCGGCTTCGACGGGCG
CTATCGGCTGATCGAAGGCGGCAAGCGTCAGCTCGACGACATTCGCGCCCGCCTCGAACAGATGATCCGC
GCACAGCGCGGCGCGGTGGAACGGGCGCTGTCGCCGCACTGGCGGCCTGCCGACCGCGAACGCAAACGGC
TGCTCGGCTTTCTGCCGCTGTGGGTGGCGCTCGCGCTCGCAGCCGCCGTGCTGATGACAGCGGGCCTCGT
GCTCGGCCTGCGCATCAACGCCTTCTCGGACCCGGTTTTCGCCGCGATGCGCGCGATCCGGGTCGCGCCC
GCGCCGGTGCTCGCCGACAAGACGAAGGCCGCGCCCAAGCTGGCCGCCGCGCTGAGCGGCTTCCTCGCGC
CGGAGATCGCGCAGGGACTGGTGACGGTCGGCGAGTCGGCGGACCGCACGACCGTCACGCTCAACAACAC
GGCGCAAGGCGTGCAGATTTTCGCGTCCGGCAGCGCCGATCTCGATGCGCATTTCGCCCCGCTCGTGCAG
CGCATCGGCGAAGCCTTGCGCGACAAGCCGGGCAATGTCGTCGTGATCGGCCATACGGACAACCAGCGCA
TCGTGTCGGCGCGCTTTCCGTCGAACGTGGCGCTGTCGCAGGCGCGCGCGGACAAGGTGCGCGCGATGCT
CGCCGCGAAACTGCCCGATCCCGCCCGGGTCAGCGCCGAAGGACGCGGCGACACGGAGCCGGTCGCATCG
AACGATACGGCCGCCGGGCGCGCACGCAATCGCCGCGTGAGCATCGACATTCTTTCGCCGGGAGCCGCAC
CATGA