SecReT6
Protein ID: 377807764
SecReT6 ID517
T6SS typei3
Gene symbol-
Locus tagBYI23_C003720
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]432898..433425 [+]
Producthypothetical protein
NoteTagF
UniProt IDG8MG01
KEGG IDbyi:BYI23_C003720
PDB IDNA
Domain hit(s) vs Pfam DUF2094 [PF09867], Evalue: 1.80E-40, Aligned region: 4..136
Protein Sequence: 175 a.a.     [Download]
>gi|377807764|ref|YP_004978956.1| hypothetical protein BYI23_C003720 [Burkholderia sp. YI23]
MSAGFYGKVRTHGDFVGRGLPDSFVKTCDAWLQRGLLTARQRAPEDWLEHYLAMPVWRFCASPGSFDECA
YAGVLMPGIDAVGRYFPLIVARQTDGASCAADSPWHDAAATLALSTLAPSFSLPAFEARLAALPAPPFRA
MSCDSGSAWWTEAGGEAHRHTGALDSALFLRLLGD
 
Nucleotide Sequence: 528 bp     [Download]
>gi|377807392|ref|NC_016590.1|:432898-433425 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAGCGCGGGCTTCTATGGCAAGGTCCGCACGCACGGAGACTTCGTCGGGCGCGGTTTGCCGGACTCAT
TCGTGAAAACCTGCGACGCCTGGCTGCAACGCGGCCTGCTGACGGCCCGCCAGCGTGCGCCGGAGGACTG
GCTCGAACACTATCTCGCGATGCCCGTGTGGCGCTTCTGCGCAAGTCCCGGCTCGTTCGACGAATGCGCG
TATGCCGGCGTGCTGATGCCCGGCATCGATGCGGTGGGGCGCTATTTCCCGTTGATCGTCGCGCGGCAAA
CCGACGGCGCGTCGTGCGCCGCCGATTCGCCGTGGCACGACGCGGCGGCTACGCTTGCGCTGTCCACGCT
CGCGCCGTCGTTTTCATTGCCCGCATTCGAGGCGCGGCTCGCCGCATTGCCTGCGCCGCCGTTCCGTGCA
ATGTCGTGCGATAGCGGCAGCGCGTGGTGGACGGAAGCGGGCGGCGAAGCGCATCGGCACACAGGCGCGC
TCGACTCCGCCTTGTTCTTGCGTCTGCTCGGCGACTGA