SecReT6
Protein ID: 377808414
SecReT6 ID518
T6SS typei2
Gene symbol-
Locus tagBYI23_C010220
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]1197184..1199844 [-]
Producthypothetical protein
NoteTssI
UniProt IDG8MHV1
KEGG IDbyi:BYI23_C010220
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-53, Aligned region: 30..346
Phage_GPD [PF05954], Evalue: 1.50E-53, Aligned region: 574..604
DUF2345 [PF10106], Evalue: 4.50E-45, Aligned region: 552..552
DUF2345 [PF10106], Evalue: 4.50E-45, Aligned region: 602..750
T6SS_Vgr [PF13296], Evalue: 9.10E-30, Aligned region: 480..585
Phage_base_V [PF04717], Evalue: 2.50E-10, Aligned region: 399..474
Phage_base_V [PF04717], Evalue: 2.50E-10, Aligned region: 642..671
Protein Sequence: 886 a.a.     [Download]
>gi|377808414|ref|YP_004979606.1| hypothetical protein BYI23_C010220 [Burkholderia sp. YI23]
MSMVVPSQAYTLLLKPQPAPLVVLNWSGKAAISQLYEYKIEFTSAADISMDEVVGRPATFSVESEDPSAG
HLQQMFGERWKDFSKMPKRYDTHGIIQQFEVLGTSADETRYRVTLAPKIADLSRVRKSRLFQKQSVVEIV
TDTLRHYGYRLGVDFDFLKLRGKYKRHEYITQYHESTFGFIQRLCAEEGLWFRFEQKHDRTIIVFGDDLD
AYARKQRIIPYRSHSGLESAGAESIRSLRTITHRVPEAIQLNDYNHRQADVNLLVEANAAPADKTTDGVD
NHWGEHYETLEEGEEIARRRHEEHLATQISYRGRGNPFSLEIGEVVGLDVNPKDAPHGLFVTSIRCGGGR
AASYWCAFRAIPADRRWRTSIESVKRPKIEGVLPARIDSPGKYTYSYVSEKGLYVVKMPFDLDEWSPGGR
SRAIRMMRPYAGANYGHHFPLIDGTEVGLIFTAQDPNRPVIAGSLHDSLNPDLVNNLNHTRNILRTAALN
EMRMEDKRGFEHIHLTTPFQTSELNLGHMVDGDRKERGRGAELRSDEHIAVRGGKGVFISADAQNAAGGK
QLDMQPAQSLLEQALLQTQSLAETAKAAQAIAADYENQKALLDGTLRELRKAAVLVSAPAGVGVASGDHL
QLSAAKNIIVTAGGNADIGVLRRFTVAAGEAVSIFAQRLGMKLFAKGKVEVQSQGDGMALSALKDVTISS
VDGRLVLSAAKEIWIGAGGSYIKINGNRIENGTPGDILEKCAVWSKPSAASAQISSKLPDSLPGQPLMIN
LAASPASKGVIPAGMPYTLLANGNVVSKGLISQNGQIPVNHTVTTKEYRLELANGVAFSVPVAENYRGDA
ANGELANQGFQFHEGLARSEDAIDRAVHRKRYSDLLNSTDSEDSDV
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c1199844-1197184 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGTCGATGGTGGTACCGTCTCAAGCCTATACATTACTGCTCAAGCCACAACCCGCACCGCTGGTCGTGT
TGAATTGGTCAGGTAAAGCGGCTATCAGCCAGTTGTACGAGTACAAGATCGAGTTTACGAGTGCTGCCGA
CATTTCGATGGATGAAGTCGTAGGACGGCCCGCGACATTCAGCGTCGAGTCCGAGGACCCCTCAGCAGGC
CATTTGCAGCAAATGTTCGGCGAGCGCTGGAAAGACTTCAGCAAGATGCCCAAACGCTATGACACGCATG
GGATCATCCAGCAATTCGAGGTACTTGGAACATCGGCCGACGAAACGCGGTATCGCGTCACGCTGGCGCC
GAAAATAGCTGATTTGTCAAGAGTTCGAAAAAGCAGGCTATTCCAAAAGCAAAGCGTTGTCGAGATCGTT
ACCGACACCCTGCGTCACTACGGCTATCGCCTAGGCGTGGACTTTGATTTCCTCAAGCTGCGCGGCAAGT
ACAAACGTCACGAATATATCACTCAGTATCACGAATCGACCTTCGGATTCATACAAAGGCTCTGTGCTGA
AGAGGGGTTGTGGTTCCGGTTCGAGCAAAAGCACGATCGAACGATCATCGTCTTTGGCGATGATTTGGAT
GCCTACGCCAGAAAGCAGCGGATCATTCCCTATCGCAGCCACTCGGGCCTCGAAAGCGCGGGGGCCGAGT
CGATCCGCTCGCTCAGGACGATTACGCATCGCGTGCCTGAAGCGATCCAGTTGAACGACTATAACCATCG
TCAGGCCGATGTGAACCTGCTGGTGGAGGCGAACGCCGCGCCGGCGGACAAGACCACCGACGGCGTCGAT
AACCACTGGGGCGAGCACTATGAAACGCTCGAAGAGGGCGAGGAGATCGCACGCCGGCGTCACGAAGAGC
ATCTGGCTACGCAGATTAGCTATCGGGGGCGTGGCAATCCGTTCTCGCTCGAAATCGGCGAGGTGGTTGG
CCTCGACGTGAACCCGAAGGATGCGCCGCACGGTCTTTTTGTGACATCGATCCGATGCGGCGGCGGCCGG
GCCGCGTCGTACTGGTGCGCGTTCCGGGCGATTCCGGCGGATCGCAGATGGCGGACCAGCATCGAATCGG
TCAAGCGTCCGAAAATTGAAGGCGTGTTGCCCGCGCGAATCGATTCGCCGGGAAAATACACCTATAGCTA
TGTGAGCGAGAAAGGCCTGTACGTCGTCAAGATGCCGTTCGATCTGGACGAGTGGAGTCCGGGCGGGCGC
AGCCGTGCGATCCGCATGATGAGGCCTTATGCGGGGGCGAACTACGGGCATCATTTCCCGCTGATCGACG
GGACCGAAGTTGGGCTGATCTTCACAGCGCAAGACCCGAACAGGCCGGTGATAGCTGGGTCACTTCATGA
CAGTCTGAATCCCGATCTCGTCAATAACCTTAACCATACGCGAAATATCCTTCGCACGGCCGCGCTCAAT
GAGATGCGCATGGAGGATAAGCGAGGGTTTGAGCATATTCACCTGACCACGCCGTTTCAGACCAGCGAGT
TGAATCTGGGGCATATGGTCGATGGGGATCGCAAGGAGAGGGGGCGCGGCGCGGAGCTGAGGAGCGACGA
GCACATAGCCGTTCGTGGCGGTAAGGGCGTCTTCATCTCGGCCGATGCGCAGAATGCGGCGGGCGGCAAA
CAGCTTGACATGCAACCGGCTCAAAGCCTGCTCGAACAAGCTTTGCTGCAGACGCAATCCCTCGCGGAAA
CTGCCAAGGCGGCACAGGCTATCGCGGCGGACTACGAGAATCAGAAGGCGCTGCTCGACGGCACGCTGCG
CGAACTGAGGAAGGCGGCTGTGCTCGTCAGCGCTCCAGCGGGCGTGGGTGTTGCATCGGGTGACCATCTG
CAATTGAGTGCGGCCAAAAACATCATTGTCACAGCGGGCGGCAATGCCGATATCGGCGTGTTGCGACGCT
TCACTGTGGCGGCGGGCGAAGCTGTGTCGATCTTCGCGCAACGGCTGGGGATGAAGCTCTTCGCGAAAGG
CAAAGTCGAGGTGCAGTCGCAGGGCGACGGGATGGCGCTGTCGGCGCTCAAGGACGTGACCATTTCCAGC
GTGGACGGTCGGCTCGTGCTGTCGGCGGCCAAGGAGATCTGGATTGGCGCGGGCGGTTCGTACATCAAGA
TCAACGGCAATCGCATCGAAAATGGGACGCCGGGGGACATTCTTGAGAAGTGCGCGGTGTGGAGCAAACC
GAGTGCGGCGTCGGCGCAGATTAGTTCGAAACTGCCGGACAGCTTGCCGGGTCAGCCGCTGATGATCAAT
TTGGCGGCATCGCCCGCATCCAAAGGCGTTATTCCTGCCGGCATGCCATACACACTACTTGCTAACGGCA
ATGTCGTGAGCAAAGGGCTGATCAGCCAAAACGGTCAGATACCTGTGAATCACACGGTCACAACGAAGGA
GTATCGGTTGGAGTTGGCAAACGGCGTGGCTTTCTCCGTGCCGGTTGCTGAGAACTATCGGGGCGATGCC
GCCAACGGTGAACTCGCTAACCAAGGTTTTCAGTTTCACGAAGGATTGGCTAGGTCAGAGGATGCGATCG
ACAGGGCCGTTCATCGCAAGCGCTACAGCGATCTATTGAATTCAACAGACTCAGAAGATAGTGATGTCTA
A