SecReT6
Protein ID: 377808415
SecReT6 ID518
T6SS typei2
Gene symbolevpB
Locus tagBYI23_C010230
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]1200236..1201789 [-]
Producttype VI secretion protein, EvpB
NoteTssC
UniProt IDG8MHV2
KEGG IDbyi:BYI23_C010230
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-177, Aligned region: 93..513
Protein Sequence: 517 a.a.     [Download]
>gi|377808415|ref|YP_004979607.1| type VI secretion protein, EvpB [Burkholderia sp. YI23]
MNKKEARASAAGETVVLDAPQASQGDSVYAALCDKINLSPVSQARPLEAFRDNDMLSEASADERLARGMG
AFLDLVAQTSKPVDRLDKSLLDFFIGQLDRQISRQLDSVMHNPEFQALEGRWRGLKMLVSRTDFRKNARI
EVLDVSKDALVRDFEDAPELIQSGLYRLTYIEEYDTPGGQPISAMISDFEFANSPQDVALLRNISKVAAA
AHMPFIGSVGAAFFGKKSMEEVAAIQDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGKDTT
PVRAFNYEEQVKGPDHDRYLWVNASFAFAANMTRSFVNNGWCVQIRGPQAGGKVEDLPVHLYDLGTGVQP
KIPTEVLIPETREFEFANLGFIPLSFYKNHDFACFFSANSSQKPALYETKEATANSRINARLPYIFLLSR
IAHYLKLIQRENIGTTKDRRLLELELNNWIKGLVTEMKDPGDELQASHPLREAKVMVEDIEDNPGFFRIK
LFIVPHFQVEGMDIGLSLVSQMPKAKS
 
Nucleotide Sequence: 1554 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c1201789-1200236 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAACAAGAAAGAAGCCCGCGCGAGCGCCGCTGGCGAGACCGTCGTGCTCGACGCCCCGCAAGCGTCAC
AGGGTGACAGCGTCTACGCAGCCCTTTGCGACAAGATCAACCTGAGCCCGGTGTCGCAGGCGCGCCCGCT
CGAAGCATTCCGTGACAACGACATGCTCTCCGAAGCCTCCGCCGACGAGCGCCTGGCACGCGGCATGGGC
GCGTTCCTCGATCTCGTCGCGCAGACGAGCAAGCCGGTGGATCGTCTCGACAAGTCATTGCTGGATTTCT
TCATCGGTCAACTGGACCGGCAGATCAGCCGCCAGCTCGATTCGGTCATGCACAATCCCGAATTTCAGGC
GCTGGAAGGCCGCTGGCGTGGCCTGAAGATGCTCGTATCGCGCACGGATTTCCGCAAGAACGCGCGTATC
GAGGTGCTCGACGTCTCGAAGGACGCGCTCGTGCGCGACTTCGAGGACGCGCCGGAACTGATTCAGAGCG
GGCTGTATCGCCTCACTTATATCGAGGAATACGACACGCCGGGCGGCCAGCCGATCAGCGCGATGATCAG
CGACTTCGAATTCGCGAACTCGCCGCAGGACGTGGCCTTGCTGCGCAACATCTCGAAGGTTGCGGCGGCG
GCGCATATGCCGTTCATCGGTTCGGTGGGCGCGGCCTTCTTCGGCAAGAAGTCGATGGAGGAAGTCGCGG
CCATTCAGGATATCGGCAACTATTTCGATCGCGCCGAATACATCAAGTGGAAGAGCTTCCGCGACACGGA
CGACTCGCGTTACGTCGGTCTCGTGATGCCGCGCGTGCTGGGCCGCCTGCCCTACGGCAAGGACACGACG
CCCGTGCGCGCGTTCAACTACGAGGAGCAGGTGAAGGGCCCGGACCACGATCGCTATCTGTGGGTGAATG
CGTCGTTTGCGTTCGCGGCGAACATGACGCGCAGCTTCGTGAACAACGGCTGGTGCGTGCAGATTCGCGG
CCCGCAGGCGGGCGGCAAGGTGGAAGACCTGCCGGTGCATCTGTACGACCTCGGCACCGGCGTGCAGCCG
AAGATTCCGACCGAAGTGCTGATTCCCGAGACGCGCGAGTTCGAGTTCGCCAACCTCGGCTTCATTCCGC
TCTCGTTCTACAAGAACCACGATTTCGCGTGCTTCTTCTCGGCGAACTCGTCGCAAAAGCCCGCGCTCTA
CGAGACCAAGGAAGCGACGGCGAATAGCCGCATCAACGCGCGTCTGCCGTACATCTTCCTGCTGTCGCGC
ATTGCGCATTACCTGAAGCTGATTCAGCGCGAGAACATCGGCACGACCAAGGACCGTCGTCTGCTGGAGC
TCGAACTGAACAACTGGATCAAGGGCCTCGTCACCGAGATGAAGGACCCGGGCGACGAACTGCAGGCGTC
GCATCCGCTGCGCGAGGCGAAGGTGATGGTCGAAGACATCGAGGACAACCCCGGCTTCTTCCGCATCAAG
CTGTTCATCGTGCCGCACTTCCAGGTGGAAGGGATGGATATCGGCCTGTCGCTGGTGTCGCAGATGCCGA
AGGCGAAGAGCTGA