SecReT6
Protein ID: 377808416
SecReT6 ID518
T6SS typei2
Gene symbol-
Locus tagBYI23_C010240
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]1201833..1202345 [-]
Producthypothetical protein
NoteTssB
UniProt IDG8MHV3
KEGG IDbyi:BYI23_C010240
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.30E-55, Aligned region: 5..157
Protein Sequence: 170 a.a.     [Download]
>gi|377808416|ref|YP_004979608.1| hypothetical protein BYI23_C010240 [Burkholderia sp. YI23] [TssB]
MDSFQREIPKSRVSITLDLHTGGAQKKVELPLKLLVAGDFSAGREQAPLSERKKVNIDKNNFDAVLADYA
PDLKFAAENTLASDGSELPVDLSFRSMKDFEPEQVARQIPELQALLAVRNLLRDLKSNLLDNGTFRREFE
KILKNKELSDKLRGELSQIATAATQPEGNA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|377807392|ref|NC_016590.1|:c1202345-1201833 Burkholderia sp. YI23 chromosome 3, complete sequence [TssB]
ATGGATAGCTTCCAGAGAGAGATTCCCAAAAGCCGAGTTTCGATCACGCTCGATCTGCATACGGGTGGCG
CGCAAAAGAAGGTCGAATTGCCGCTCAAGCTGCTCGTCGCGGGCGATTTCAGCGCGGGGCGCGAGCAGGC
GCCTTTGTCCGAGCGCAAGAAAGTCAACATCGACAAGAACAATTTCGACGCGGTGCTCGCCGACTACGCG
CCGGACCTGAAGTTCGCAGCCGAGAACACGCTCGCGAGCGATGGCTCGGAGTTGCCGGTCGACCTCTCTT
TCCGTTCGATGAAAGACTTCGAGCCGGAGCAGGTGGCGCGTCAGATTCCCGAGTTGCAGGCGCTGCTCGC
CGTGCGCAATCTGCTGCGGGACCTGAAGTCGAATCTGCTCGATAACGGCACGTTCCGCCGCGAGTTCGAA
AAGATCCTGAAGAACAAGGAACTGTCCGACAAGCTGCGTGGCGAGCTCTCGCAGATCGCCACGGCGGCGA
CGCAGCCCGAAGGAAACGCCTGA