SecReT6
Protein ID: 377808417
SecReT6 ID518
T6SS typei2
Gene symbol-
Locus tagBYI23_C010250
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]1202827..1204179 [+]
Producthypothetical protein
NoteTssK
UniProt IDG8MHV4
KEGG IDbyi:BYI23_C010250
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.00E-124, Aligned region: 18..447
Protein Sequence: 450 a.a.     [Download]
>gi|377808417|ref|YP_004979609.1| hypothetical protein BYI23_C010250 [Burkholderia sp. YI23]
MRIDKPLWHEGLILTQQHFQQQERWTEFTLRQFTTASLAQPWGTLGVEVDEDALAAGRFKLSRLKLRFPD
GTPIDTSAAQPLPPARDLSQGVGSDRQSVTVLAALALPDANGNNCRMDESTLTRPRRSYREFVKVVDLNG
SDDVEIAAERHAVRLLFDFEPHADDTVCAIARLTRSTSGQFQLDRRYVPPCLSLGAHTLHVERITRMADI
LLAKSLALGARRSERIEQVAEYGVADVQLFWLLHCIHAAWPRLRFLASNPNLPPERLYAVLSELASALLT
FSTGSQLTDIPSYDHVRADEVFAEIESMIRNLLDAIIPSRVVPIDLSHDNATTWNGKILDTRIADGAADW
YLSVNSTLPAFELVERIPRLCKIGAPDEVDHIVNSALAGIALKAVQRVPAAIPVRLDNQYFALDAASPAL
ARMLAARACQIYLPTSVPDVSLELYAVLRS
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|377807392|ref|NC_016590.1|:1202827-1204179 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGCGGATAGACAAACCGCTTTGGCACGAAGGCCTGATTCTCACGCAGCAGCATTTCCAGCAACAGGAAA
GGTGGACGGAGTTCACTCTGCGCCAGTTCACGACGGCCTCGCTCGCGCAACCGTGGGGAACGCTCGGCGT
CGAAGTCGACGAAGACGCGCTTGCCGCCGGCCGTTTCAAGCTCTCGAGGCTGAAGCTACGGTTTCCCGAC
GGCACGCCCATCGACACCTCGGCCGCGCAGCCGTTGCCGCCCGCGCGCGATCTGTCGCAAGGCGTGGGTT
CGGACCGGCAAAGCGTCACGGTGCTCGCCGCGCTCGCCCTGCCCGATGCCAACGGCAACAACTGCCGTAT
GGACGAATCGACACTCACGCGTCCGCGCCGCTCGTACCGCGAGTTCGTCAAGGTGGTCGATCTGAACGGC
TCGGACGATGTCGAGATCGCCGCGGAGCGTCATGCCGTGCGCCTGCTCTTCGATTTCGAGCCGCATGCCG
ACGACACCGTCTGCGCCATCGCGCGTCTCACGCGATCGACGAGCGGACAGTTCCAGCTCGACCGCCGCTA
CGTGCCGCCTTGCCTGTCGCTCGGCGCGCACACGCTGCATGTGGAGCGCATCACGCGCATGGCGGACATC
CTGCTGGCCAAAAGCCTCGCGCTCGGCGCGCGGCGCAGCGAACGCATCGAACAGGTGGCCGAATACGGCG
TCGCCGACGTCCAGTTGTTCTGGTTGCTGCACTGCATTCATGCGGCGTGGCCCAGGCTGCGGTTCCTCGC
GTCGAATCCGAACCTGCCGCCCGAGCGGCTGTACGCGGTGCTATCCGAACTCGCGAGCGCCCTCCTGACC
TTCTCCACGGGTTCGCAACTCACGGATATCCCGTCCTACGACCATGTTCGCGCGGACGAAGTGTTCGCCG
AGATCGAGTCGATGATCCGGAATCTGCTCGACGCGATCATCCCGTCGCGGGTCGTGCCGATCGATCTCTC
GCATGACAACGCGACGACCTGGAACGGCAAGATTCTCGATACGCGCATCGCGGACGGCGCCGCCGACTGG
TATCTGTCGGTCAACTCGACGCTGCCCGCCTTCGAGCTCGTCGAACGGATTCCGCGCCTGTGCAAGATCG
GCGCGCCGGACGAAGTCGATCACATCGTCAATTCGGCACTCGCGGGCATCGCGCTGAAAGCCGTCCAGCG
CGTACCGGCCGCGATCCCCGTGCGTCTCGACAATCAATATTTCGCGCTCGATGCGGCGAGCCCGGCGCTC
GCACGCATGCTGGCCGCACGGGCTTGCCAGATCTATCTGCCGACATCCGTGCCCGATGTCTCGCTCGAAC
TCTACGCGGTGCTGCGCTCATGA