SecReT6
Protein ID: 377808418
SecReT6 ID518
T6SS typei2
Gene symbol-
Locus tagBYI23_C010260
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]1204176..1204904 [+]
Producthypothetical protein
NoteTssL
UniProt IDG8MHV5
KEGG IDbyi:BYI23_C010260
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 6.90E-45, Aligned region: 28..227
Protein Sequence: 242 a.a.     [Download]
>gi|377808418|ref|YP_004979610.1| hypothetical protein BYI23_C010260 [Burkholderia sp. YI23]
MNMLTSSRAHAPLVEPTSGAASASASGIRDLLRDTALFVATLSTGGAAGDFEALRARCTSMVADFSAALD
RRGYPEDVRDDALKAQCALLDETALQHLSGQDRSNWSAYPLQVQQFNQHDAGERVFERLELRMRERSPQT
DLLECYAAILGLGFLGRYALHGANERQALMAELNALIERLRPQRERSLVIDQPGRRFGDAFRRMSPWAIS
ALGCIVALVTWLVWHAALDAQLAALLPHTVKP
 
Nucleotide Sequence: 729 bp     [Download]
>gi|377807392|ref|NC_016590.1|:1204176-1204904 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAACATGCTGACTTCGTCTCGCGCGCACGCGCCGCTCGTCGAACCGACGTCGGGGGCGGCCTCTGCAT
CCGCGAGCGGCATCCGCGATCTCCTGCGCGACACCGCGCTCTTCGTGGCGACGCTGTCGACAGGCGGCGC
GGCCGGAGACTTCGAAGCCCTGCGCGCGCGCTGCACGTCGATGGTCGCCGATTTCAGCGCGGCGCTCGAT
CGCCGGGGCTATCCCGAAGACGTGCGCGACGACGCATTGAAAGCGCAATGCGCGCTGCTCGACGAAACCG
CGCTCCAGCATCTTTCCGGACAAGACAGGTCGAACTGGTCCGCTTATCCATTGCAAGTGCAGCAGTTCAA
TCAGCACGATGCCGGCGAGCGCGTGTTCGAACGGCTGGAGTTGCGCATGCGCGAGCGATCGCCGCAGACC
GACCTGCTCGAATGCTACGCGGCGATTCTCGGTCTCGGATTTCTCGGCCGCTACGCGCTCCACGGCGCGA
ACGAGCGGCAAGCGCTCATGGCCGAACTGAACGCGCTGATCGAGCGGCTTCGTCCGCAGCGCGAGCGTTC
GCTCGTCATCGACCAGCCGGGACGGCGTTTCGGCGACGCGTTCCGGCGCATGTCGCCGTGGGCGATCTCG
GCACTCGGCTGCATCGTCGCGCTCGTCACCTGGCTCGTCTGGCATGCCGCGCTCGATGCGCAGCTCGCCG
CGCTGCTCCCGCACACCGTCAAGCCGTGA