SecReT6
Protein ID: 377808421
SecReT6 ID518
T6SS typei2
Gene symbol-
Locus tagBYI23_C010290
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]1207288..1209954 [+]
ProductATPase with chaperone activity ATP-binding subunit
NoteTssH
UniProt IDG8MHV8
KEGG IDbyi:BYI23_C010290
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.40E-39, Aligned region: 234..252
AAA_2 [PF07724], Evalue: 2.40E-39, Aligned region: 611..775
AAA [PF00004], Evalue: 1.50E-19, Aligned region: 236..348
AAA [PF00004], Evalue: 1.50E-19, Aligned region: 616..743
AAA_16 [PF13191], Evalue: 1.20E-13, Aligned region: 213..253
AAA_16 [PF13191], Evalue: 1.20E-13, Aligned region: 281..314
AAA_16 [PF13191], Evalue: 1.20E-13, Aligned region: 464..464
AAA_16 [PF13191], Evalue: 1.20E-13, Aligned region: 584..654
AAA_16 [PF13191], Evalue: 1.20E-13, Aligned region: 679..710
AAA_16 [PF13191], Evalue: 1.20E-13, Aligned region: 753..843
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 236..253
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 311..366
AAA_5 [PF07728], Evalue: 3.40E-13, Aligned region: 615..735
ClpB_D2-small [PF10431], Evalue: 3.70E-13, Aligned region: 782..855
AAA_22 [PF13401], Evalue: 3.10E-08, Aligned region: 235..326
AAA_22 [PF13401], Evalue: 3.10E-08, Aligned region: 614..634
AAA_22 [PF13401], Evalue: 3.10E-08, Aligned region: 676..709
Arch_ATPase [PF01637], Evalue: 2.60E-06, Aligned region: 214..390
Arch_ATPase [PF01637], Evalue: 2.60E-06, Aligned region: 614..627
Clp_N [PF02861], Evalue: 7.00E-06, Aligned region: 24..75
Clp_N [PF02861], Evalue: 7.00E-06, Aligned region: 109..123
Clp_N [PF02861], Evalue: 7.00E-06, Aligned region: 466..479
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 236..260
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 289..331
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 608..640
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 794..816
AAA_19 [PF13245], Evalue: 3.20E-05, Aligned region: 233..259
AAA_19 [PF13245], Evalue: 3.20E-05, Aligned region: 613..637
AAA_17 [PF13207], Evalue: 5.30E-05, Aligned region: 236..369
AAA_17 [PF13207], Evalue: 5.30E-05, Aligned region: 614..651
Sigma54_activat [PF00158], Evalue: 8.70E-05, Aligned region: 219..250
Sigma54_activat [PF00158], Evalue: 8.70E-05, Aligned region: 614..733
IstB_IS21 [PF01695], Evalue: 9.10E-05, Aligned region: 218..256
IstB_IS21 [PF01695], Evalue: 9.10E-05, Aligned region: 480..517
IstB_IS21 [PF01695], Evalue: 9.10E-05, Aligned region: 615..633
IstB_IS21 [PF01695], Evalue: 9.10E-05, Aligned region: 728..759
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 228..251
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 612..640
NACHT [PF05729], Evalue: 0.00074, Aligned region: 236..263
NACHT [PF05729], Evalue: 0.00074, Aligned region: 615..634
TIP49 [PF06068], Evalue: 0.0012, Aligned region: 218..255
TIP49 [PF06068], Evalue: 0.0012, Aligned region: 284..316
TIP49 [PF06068], Evalue: 0.0012, Aligned region: 614..650
AAA_18 [PF13238], Evalue: 0.0019, Aligned region: 236..250
AAA_18 [PF13238], Evalue: 0.0019, Aligned region: 616..636
Zeta_toxin [PF06414], Evalue: 0.004, Aligned region: 236..256
Zeta_toxin [PF06414], Evalue: 0.004, Aligned region: 316..364
Zeta_toxin [PF06414], Evalue: 0.004, Aligned region: 601..655
Hpr_kinase_C [PF07475], Evalue: 0.0087, Aligned region: 236..246
Hpr_kinase_C [PF07475], Evalue: 0.0087, Aligned region: 613..632
Protein Sequence: 888 a.a.     [Download]
>gi|377808421|ref|YP_004979613.1| ATPase with chaperone activity ATP-binding subunit [Burkholderia sp. YI23]
MTLRDSTHLLRRLNPHCARTLEAAASLCQTRLADEITVEHWLLKLIEADDGDIPAILRHYEIDVEAIWNA
LLAAIDRLPRTLRGMPSLSIQLASVLQDAWNLASREDIDGTIRSAHLLSAIIAAPHAMRTQDAWPLFSLS
GAQIERVLARLGRASCENAPAQEEEDDAATGDTAAAPAPATSATPSRSTEGEALARFAIDLTDKARRGEI
DPVFGRDREIQQMIDVLVRRRKNNPILVGEPGVGKTALVEGFALRVAEGSVPSPLRDVRILTLDLGLLQA
GAGVKGEFEQRLKNVIDEVKASATPIVLFIDEAHTLIGAGNSAGGSDAANLLKPALARGELRTIAATTWS
EYKEYFERDAALERRFQMVKVEEPDDEAACLMLRGLATRYAKHHDVHIRDEALVAAVKLSRRYIPARQLP
DKAVDLIDTAAARVRMGLDTPPAELQRARAAVAALELERSAIDADERAGIDDTAVRRETLVAALAQANHE
LADVQARYERERSLVQALLKQRGDGPTGPDAHAFAMGNKALADAQGKTPLIFADVDAQAIARVVAEWTGV
PVGNLVEDELLNLLTLEDQLQKRVVAQDDALGMLAQSLRTAKAGLKSEHAPLGVFLLTGTSGVGKTETAL
ALADVLFGGEAALTTINMSEYQEAHSVSQLKGSPPGYVGYGRGGILTEAVRQRPYSVVLLDEVEKAHRDV
LDMFYQVFDRGSMRDGEGREIDFRNCVILMTSNLGSEQIHDAATDMPDIAHAALLDAVHEPLVRHFQPAL
LARFQTLVYRPLDVSALGSIVRLKIAKIAGRLKRQHGVTLVCDDSLIASLAELSLSRESGARSIDAFLDQ
RILPTVSRELLTRMASGAAPAEVRLAQSEEGNLTIEFVDCDEAGFAAV
 
Nucleotide Sequence: 2667 bp     [Download]
>gi|377807392|ref|NC_016590.1|:1207288-1209954 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGACTCTGCGCGATTCCACTCATCTGCTTCGCCGTCTCAACCCGCACTGCGCCCGCACGCTCGAAGCGG
CCGCGAGCCTGTGCCAGACGCGCCTCGCCGACGAAATCACCGTCGAGCACTGGCTGCTGAAGCTGATCGA
GGCGGACGACGGAGATATTCCGGCGATCCTGCGTCACTATGAGATCGATGTCGAGGCAATCTGGAACGCG
CTGCTCGCAGCCATCGATCGCCTTCCGCGCACGCTGCGCGGCATGCCGTCGCTCTCCATTCAGCTCGCGA
GCGTGTTGCAGGACGCGTGGAATCTCGCGTCGCGTGAAGATATCGACGGCACGATCCGCTCGGCGCATCT
GCTGAGCGCGATCATCGCCGCGCCGCACGCGATGCGCACGCAGGACGCGTGGCCGCTCTTCTCCCTATCC
GGCGCGCAGATCGAGCGCGTGTTGGCGCGTCTCGGACGCGCATCGTGCGAAAACGCGCCCGCACAGGAAG
AAGAGGACGATGCCGCGACCGGCGACACCGCGGCCGCACCCGCGCCGGCAACGTCCGCAACGCCGTCGCG
CTCGACCGAAGGCGAAGCCCTCGCACGCTTCGCGATCGATCTCACGGACAAGGCGCGCCGCGGCGAGATC
GATCCGGTGTTCGGCCGCGATCGCGAAATTCAGCAGATGATCGACGTGCTCGTGCGCCGCCGCAAGAACA
ACCCGATCCTCGTCGGCGAACCGGGCGTCGGCAAGACGGCGCTCGTCGAGGGCTTCGCGCTGCGCGTGGC
GGAAGGCAGCGTGCCGTCGCCCTTGCGCGACGTGCGCATCCTCACGCTCGATCTCGGGCTGCTGCAAGCC
GGCGCGGGCGTGAAAGGCGAATTCGAGCAGCGCCTGAAGAACGTGATCGACGAGGTGAAGGCGTCGGCGA
CGCCGATCGTGCTCTTCATCGACGAGGCGCACACGCTGATCGGCGCGGGCAATTCGGCCGGTGGCTCGGA
TGCGGCCAACCTGCTGAAGCCGGCGCTCGCGCGCGGCGAATTGCGTACCATCGCCGCGACCACCTGGTCG
GAATACAAGGAATACTTCGAGCGCGACGCGGCGCTCGAACGGCGCTTCCAGATGGTCAAGGTCGAGGAGC
CGGACGACGAAGCGGCCTGTCTCATGCTGCGCGGCCTCGCGACGCGCTACGCGAAGCATCACGACGTGCA
CATCCGCGACGAAGCGCTTGTCGCGGCGGTCAAGCTCTCGCGCCGCTATATCCCCGCGCGTCAGTTGCCG
GACAAGGCCGTCGATCTGATCGACACCGCCGCCGCGCGCGTGCGCATGGGCCTCGATACGCCGCCCGCCG
AATTGCAGCGCGCCCGTGCAGCCGTGGCGGCGCTGGAGCTCGAACGCTCGGCCATTGACGCGGACGAGCG
CGCGGGCATCGACGACACGGCCGTGCGCCGTGAAACGCTCGTCGCCGCGCTCGCGCAGGCGAATCACGAA
CTGGCCGACGTTCAGGCGCGCTACGAGCGCGAGCGCTCGCTGGTTCAGGCGCTGCTGAAACAGCGCGGCG
ACGGCCCGACCGGGCCGGACGCGCACGCGTTCGCGATGGGAAACAAGGCGCTCGCCGACGCGCAAGGCAA
GACCCCGCTGATCTTCGCCGATGTCGATGCGCAAGCCATTGCCCGCGTGGTCGCGGAATGGACGGGCGTG
CCGGTCGGCAATCTCGTCGAAGACGAACTGCTGAATCTGCTCACGCTGGAAGATCAGCTGCAAAAACGCG
TGGTCGCGCAGGACGACGCGCTCGGCATGCTCGCGCAAAGCCTGCGCACCGCGAAAGCGGGGCTCAAGAG
CGAGCACGCGCCGCTCGGCGTATTTCTGCTGACGGGTACCTCGGGGGTCGGCAAGACCGAGACGGCGCTC
GCGCTCGCCGATGTGCTGTTCGGCGGCGAGGCCGCGCTCACGACCATCAACATGTCGGAGTATCAGGAAG
CGCACTCGGTTTCGCAGTTGAAGGGCTCGCCGCCGGGCTACGTCGGATACGGACGCGGCGGCATTCTGAC
CGAAGCCGTGCGTCAGCGGCCTTATAGCGTGGTGTTGCTCGATGAAGTCGAGAAGGCGCACCGCGATGTG
CTCGACATGTTCTATCAGGTGTTCGACCGCGGATCGATGCGCGATGGCGAAGGCCGCGAGATCGACTTCC
GCAATTGCGTGATTCTGATGACCTCGAACCTCGGCAGCGAGCAGATCCACGACGCGGCCACGGACATGCC
CGACATCGCGCACGCCGCGCTGCTCGACGCTGTCCATGAACCGCTCGTCAGGCACTTCCAGCCGGCGCTG
CTCGCGCGCTTCCAGACGCTCGTCTACCGGCCGCTGGATGTGAGCGCCCTCGGCAGCATCGTGCGGCTGA
AGATCGCGAAGATCGCCGGTCGCCTGAAGCGGCAGCACGGCGTCACACTCGTCTGCGACGACTCGCTGAT
CGCATCGCTCGCCGAGCTGAGCCTGTCGCGCGAATCGGGCGCGCGCAGCATCGACGCGTTCCTCGATCAG
CGCATTCTGCCGACAGTATCGCGCGAACTGCTCACACGAATGGCGAGCGGCGCCGCGCCTGCAGAGGTTC
GTCTCGCGCAGTCGGAAGAAGGCAATCTGACGATCGAGTTCGTGGATTGCGATGAAGCCGGTTTTGCGGC
CGTTTGA