SecReT6
Protein ID: 377808422
SecReT6 ID518
T6SS typei2
Gene symbol-
Locus tagBYI23_C010300
StrainBurkholderia sp. YI23
Repliconchromosome III [GenBank: NC_016590] [Browse all T6SS(s) in this replicon]
Location [Strand]1209929..1210387 [+]
Producthypothetical protein
NoteTssE
UniProt IDG8MHV9
KEGG IDbyi:BYI23_C010300
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.20E-17, Aligned region: 41..125
Protein Sequence: 152 a.a.     [Download]
>gi|377808422|ref|YP_004979614.1| hypothetical protein BYI23_C010300 [Burkholderia sp. YI23]
MKPVLRPFEASMPGPSLYEMLLGQIDGEPLADFDDRTLEILSVQQNVRRILNTRAGALKHLPDYGLPDLT
NIYKALPASSQALKEQMETTVLKYEPRIRAIDIQMIETPEPGLQVSFEMICHLKRAGLVRFGTYFTPPGV
FRLERRVREGKI
 
Nucleotide Sequence: 459 bp     [Download]
>gi|377807392|ref|NC_016590.1|:1209929-1210387 Burkholderia sp. YI23 chromosome 3, complete sequence
ATGAAGCCGGTTTTGCGGCCGTTTGAGGCGAGCATGCCCGGCCCGTCCCTCTACGAAATGCTGCTTGGCC
AGATCGACGGCGAGCCGCTCGCGGATTTCGACGACCGCACGCTCGAAATCCTGAGCGTGCAACAGAACGT
GCGGCGCATTCTGAACACGCGGGCCGGTGCGCTCAAGCATCTGCCCGACTATGGCTTGCCCGATCTGACC
AACATCTACAAGGCGCTGCCCGCGTCGTCTCAGGCGCTCAAGGAGCAGATGGAAACGACGGTCCTGAAGT
ACGAACCGCGTATCCGGGCGATCGACATCCAGATGATTGAGACGCCCGAGCCGGGACTGCAAGTCAGTTT
CGAAATGATCTGCCATCTGAAGCGCGCGGGGCTCGTGCGCTTCGGGACGTATTTCACGCCGCCCGGCGTT
TTCAGGCTGGAGCGGCGCGTGCGTGAGGGGAAGATTTAG