SecReT6
Protein ID: 378448584
SecReT6 ID551
T6SS typei3
Gene symbol-
Locus tagSTM14_0321
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 14028S
Repliconchromosome [GenBank: NC_016856] [Browse all T6SS(s) in this replicon]
Location [Strand]315199..316692 [+]
Productputative cytoplasmic protein
NoteTssC
UniProt IDD0ZL27
KEGG IDseo:STM14_0321
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.30E-191, Aligned region: 64..490
Protein Sequence: 497 a.a.     [Download]
>gi|378448584|ref|YP_005235943.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
MANSNMQATDAVAQDTASASGEFDALLNQAFRPKTTQAAKAVEAAVQTLANTITVSDDAYKSISAIIAQI
DFKLTEQIKLILQHPDWQKLESSWRGMEHLVYNTETDEKLKIRFMNLSKDELRRNMKRYKGIAWDQSPMF
KKLYEAEYGQLGGEPYGCIIADYYFDHTPPDVDLLGSIAKVAASAHAPFIAGASPSVLQMDSWQELANPR
DLTKIVTQNLEYAPWNSLRASEDSRYIGLTMPRFLARLPYGAKTNPVDEFDFEEDADGSDHTKYVWSNAA
YAMGVNINRSFKHYGWCTLIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFIPL
IHRKNSDYAAFIGAQSLQKPQEYYDPDATANANLSARLPYLFACSRFAHFLKCIVRDKIGSFKEREDMQR
WLNEWIMNYVDADPVNSSQETKARRPLAAAEVVVEEVEGNPGYYDAKFFLRPHFQLEGLTGSLRLVTKLP
SVKQGNA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|378448274|ref|NC_016856.1|:315199-316692 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S chromosome, complete genome
ATGGCAAACAGTAATATGCAGGCAACCGACGCGGTTGCTCAGGATACCGCCTCCGCATCCGGTGAATTTG
ATGCGTTGCTGAATCAGGCCTTCCGACCCAAGACTACCCAGGCGGCAAAAGCCGTGGAAGCCGCGGTGCA
GACGCTGGCGAACACGATCACCGTCAGCGATGACGCCTATAAAAGCATCAGCGCTATTATTGCGCAGATC
GACTTTAAACTGACCGAACAGATCAAACTGATCCTGCAACATCCCGACTGGCAGAAGCTGGAATCCTCGT
GGCGCGGTATGGAGCATCTGGTTTACAACACCGAGACCGACGAAAAGCTGAAAATTCGCTTCATGAATCT
GTCAAAAGATGAATTGCGGCGCAACATGAAGCGTTACAAGGGCATCGCCTGGGATCAAAGCCCGATGTTC
AAGAAACTGTATGAAGCCGAATACGGCCAGTTAGGTGGCGAACCTTATGGCTGTATCATTGCGGATTACT
ACTTCGACCATACACCGCCCGATGTGGATCTGCTTGGCTCTATCGCCAAAGTCGCCGCGTCGGCCCATGC
GCCGTTTATTGCCGGGGCTTCCCCCTCGGTACTGCAAATGGACTCCTGGCAGGAACTGGCGAATCCCCGC
GACCTGACCAAAATCGTCACCCAGAACCTGGAATATGCGCCGTGGAACTCGCTGCGGGCTAGCGAAGACT
CCCGTTATATTGGCCTGACGATGCCGCGTTTTCTTGCCCGCCTGCCGTATGGCGCAAAAACCAACCCGGT
GGACGAGTTTGATTTTGAAGAAGATGCGGATGGTTCTGACCATACCAAATACGTCTGGAGCAACGCGGCC
TACGCGATGGGCGTAAACATCAACCGTTCCTTCAAACACTACGGCTGGTGTACGTTGATTCGCGGTGTGG
AATCAGGCGGTGCGGTGGAAAATCTTCCCTGCCATACCTTCCCGACTGACGATGGCGGCGTGGACATGAA
ATGCCCGACCGAAATCGCCATCTCTGACCGCCGCGAGGCTGAACTGGCGAAAAACGGTTTTATCCCGTTG
ATCCACCGTAAAAACTCAGACTATGCCGCCTTTATCGGCGCACAGTCGCTGCAAAAACCACAGGAATACT
ACGATCCGGACGCGACGGCCAACGCTAACCTGTCTGCCCGTCTACCGTACCTGTTCGCCTGCTCGCGCTT
CGCTCACTTCCTCAAATGTATCGTCCGCGACAAAATCGGTTCCTTTAAAGAGCGTGAGGATATGCAGCGC
TGGCTAAATGAATGGATTATGAATTATGTCGACGCCGATCCGGTGAACTCCTCGCAAGAAACTAAAGCCC
GTCGTCCGCTGGCTGCCGCTGAAGTAGTGGTGGAAGAGGTCGAAGGCAATCCAGGTTATTACGACGCGAA
ATTCTTCCTGCGTCCGCATTTCCAGCTTGAAGGGCTGACGGGATCGCTGCGCCTGGTGACAAAACTGCCG
TCAGTGAAGCAGGGCAATGCCTGA