SecReT6
Protein ID: 378448591
SecReT6 ID551
T6SS typei3
Gene symbol-
Locus tagSTM14_0328
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 14028S
Repliconchromosome [GenBank: NC_016856] [Browse all T6SS(s) in this replicon]
Location [Strand]319916..320452 [+]
Productputative outer membrane lipoprotein
NoteTssJ
UniProt IDD0ZL34
KEGG IDseo:STM14_0328
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-41, Aligned region: 20..170
Protein Sequence: 178 a.a.     [Download]
>gi|378448591|ref|YP_005235950.1| putative outer membrane lipoprotein [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
MNEWRNPTRWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAPIEIRVYELKN
DAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTAIGVLAGYRNLAKSVWRVTYK
IPEAPEKAWYSSFISGKGKVQLEAELEQSAIVITERDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|378448274|ref|NC_016856.1|:319916-320452 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S chromosome, complete genome
GTGAATGAATGGCGTAACCCCACTCGGTGGTTATGTGCGGTAGCTATGCCTTTTGCACTGCTCCTGCTTT
CCGGATGCGGCAGTAGCGATGCGTTACCTGACCTCGAATCACAGCGACTCGACCTGAGCGTGAAAGCCTC
CGATAAGGTGAATCCTGACAATCAGAAGAAGGCCGCGCCCATTGAGATACGTGTTTATGAACTGAAAAAT
GACGCCGCTTTCACGACAGCTGATTACTGGTCGCTCCATGACAACGACAAATCCGTCCTTACCGACGATT
TAGTGCGTCGCGACAGCTTTATTTTGCGTCCCGGCGAAGAGAAAAAACTGCGTCGCCCGCTGAATGCGCA
GACCACGGCAATCGGCGTACTGGCCGGATACCGTAACCTGGCCAAATCGGTCTGGCGGGTAACCTACAAA
ATCCCGGAAGCCCCGGAAAAAGCCTGGTACAGCAGCTTCATATCGGGGAAAGGAAAAGTGCAGTTGGAGG
CGGAACTGGAACAAAGCGCCATTGTAATTACGGAACGGGATAAATGA