SecReT6
Protein ID: 378448593
SecReT6 ID551
T6SS typei3
Gene symbol-
Locus tagSTM14_0330
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. 14028S
Repliconchromosome [GenBank: NC_016856] [Browse all T6SS(s) in this replicon]
Location [Strand]321796..323100 [+]
Producthypothetical protein
NoteTssL
UniProt IDD0ZL36
KEGG IDseo:STM14_0330
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.00E-61, Aligned region: 62..266
OmpA [PF00691], Evalue: 4.90E-16, Aligned region: 193..211
OmpA [PF00691], Evalue: 4.90E-16, Aligned region: 328..426
Protein Sequence: 434 a.a.     [Download]
>gi|378448593|ref|YP_005235952.1| hypothetical protein STM14_0330 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S]
MTDSTLTPPAADMMSFLSTTPEHKDSEYETPVHTSQRTELNVIVEDGPDSKLRLAEISAAANPLLAAARP
LLCALAAMPAKLDAALVEPYRNLLVREMHLYQTLCDQANLRREHVLAVRYCLCTALDEAANNTTWGRRGV
WAGKSLLVTFHGESEGGIKLFQIIGRLAASFQEHGNVLEVIYHLLGLGFEGRYSVQPDGRKQLDNIRQQL
LTQLSQRRDPVMPALSPDFQGAISGRLRRMRRVPVWLSAGIALLAMLTLFGLYSHRMDVQTVTVQQHIDA
IGIKLPPPPVPVHKLRLKILLANEIARGLLTVDEDDQHSRVVFRGDAMFVPGQKTVSDAIRPVINKAARE
IARVGGAVTVTGHTDSQPIHSAEFPSNLVLSEKRAAEVAALLTSGGVPAGRVHIVGKGDTVPVADNGSKA
GRAKNRRVEILVVE
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|378448274|ref|NC_016856.1|:321796-323100 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S chromosome, complete genome
ATGACAGACAGTACCCTGACGCCGCCAGCGGCGGATATGATGTCCTTTTTGTCCACCACGCCGGAACATA
AGGACAGTGAATATGAAACGCCGGTACACACCAGCCAGCGCACGGAACTCAATGTCATCGTTGAAGACGG
TCCGGACAGCAAACTCCGGCTGGCTGAAATCAGCGCGGCGGCTAACCCGTTGCTCGCCGCTGCCCGGCCT
TTATTGTGCGCTCTCGCAGCCATGCCCGCTAAACTGGATGCGGCCCTGGTAGAGCCTTACCGTAATCTGC
TGGTACGCGAGATGCATCTGTACCAGACATTATGCGATCAGGCGAACCTGCGGCGCGAGCACGTACTGGC
GGTACGTTACTGCCTGTGTACGGCGCTTGATGAAGCCGCCAATAACACAACCTGGGGACGGCGCGGCGTC
TGGGCCGGAAAAAGCCTGCTGGTAACATTTCATGGTGAAAGCGAAGGCGGGATAAAACTTTTCCAGATCA
TCGGGCGTCTGGCGGCCAGCTTCCAGGAGCATGGCAACGTACTGGAGGTTATCTACCACCTGCTGGGGTT
GGGATTTGAAGGCCGCTACAGCGTGCAGCCAGACGGGCGTAAGCAACTGGACAATATTCGCCAGCAACTG
CTGACACAGCTTTCACAGCGTCGCGATCCGGTTATGCCCGCGCTCTCGCCTGACTTTCAGGGGGCGATAA
GCGGACGACTGCGGCGGATGCGCCGGGTGCCGGTCTGGCTGAGCGCCGGGATAGCCCTGTTGGCGATGCT
GACGCTGTTTGGCCTTTACAGCCACCGGATGGATGTGCAGACCGTCACCGTACAACAGCATATTGATGCG
ATTGGTATAAAACTGCCGCCGCCGCCTGTGCCGGTTCATAAGCTGCGGCTGAAAATCCTGCTGGCAAACG
AAATCGCCCGTGGCCTGCTGACCGTGGACGAAGATGACCAGCACAGTAGGGTGGTCTTCCGTGGCGACGC
CATGTTTGTGCCGGGACAGAAAACGGTGAGTGACGCAATCCGGCCAGTGATTAACAAAGCGGCGCGGGAA
ATCGCCCGCGTGGGCGGCGCAGTCACTGTAACGGGTCACACTGACAGCCAGCCCATTCATTCGGCTGAAT
TCCCATCCAACCTGGTACTGTCGGAAAAACGGGCGGCGGAAGTTGCGGCGTTGCTGACCTCCGGCGGCGT
ACCTGCCGGACGGGTACATATCGTCGGCAAGGGCGATACGGTGCCGGTGGCGGATAACGGCAGTAAAGCC
GGGCGGGCGAAAAACCGTCGGGTGGAAATTCTGGTAGTGGAGTGA