SecReT6
Protein ID: 378698248
SecReT6 ID535
T6SS typei3
Gene symbolsciK
Locus tagSL1344_0271
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Repliconchromosome [GenBank: NC_016810] [Browse all T6SS(s) in this replicon]
Location [Strand]316869..317354 [+]
Producthypothetical protein
NoteTssD
UniProt IDE1W8E1
KEGG IDsey:SL1344_0271
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.10E-41, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|378698248|ref|YP_005180205.1| hypothetical protein SL1344_0271 [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344]
MAYDIFLKIDGIDGESMDDKHKNEIEVLSWRWNIHQESTMHAGSGLGSGKVSVTNLDFDHYIDRASPNLF
KYCASGKHIPQAILVMRKAGGNPLEYLKYTFTDLIVAVVSPSGSHDGEIASRETVELSFSTVKQEYVVQN
QQGGSGGTITAGYDFKANKEI
 
Nucleotide Sequence: 486 bp     [Download]
>gi|378697983|ref|NC_016810.1|:316869-317354 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344, complete genome
ATGGCTTATGACATTTTTTTGAAAATTGACGGCATTGATGGCGAGTCAATGGATGACAAACACAAAAATG
AAATTGAAGTACTGAGCTGGCGCTGGAATATTCATCAGGAATCCACCATGCACGCCGGTAGCGGCCTCGG
CTCCGGTAAGGTCTCCGTCACCAACCTGGATTTTGATCACTATATCGACCGCGCCAGCCCGAACCTGTTC
AAATACTGCGCCTCCGGCAAGCACATTCCGCAGGCCATTCTGGTTATGCGTAAGGCTGGCGGCAATCCGC
TGGAGTACCTCAAGTATACCTTCACCGACCTGATTGTCGCCGTGGTTTCCCCGAGCGGCAGCCACGATGG
TGAAATCGCCTCCCGTGAAACGGTGGAGCTCTCCTTCAGCACCGTGAAGCAGGAATACGTGGTGCAGAAC
CAGCAGGGCGGCAGCGGCGGCACCATCACCGCAGGCTACGACTTCAAGGCCAACAAAGAAATTTAA