SecReT6
Protein ID: 378698249
SecReT6 ID535
T6SS typei3
Gene symbol-
Locus tagSL1344_0272
StrainSalmonella enterica subsp. enterica serovar Typhimurium str. SL1344
Repliconchromosome [GenBank: NC_016810] [Browse all T6SS(s) in this replicon]
Location [Strand]317659..318144 [+]
Producthypothetical protein
NoteSTM0277 (e)
UniProt IDE1W8E2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 4.00E-28, Aligned region: 40..141
Protein Sequence: 161 a.a.     [Download]
>gi|378698249|ref|YP_005180206.1| hypothetical protein SL1344_0272 [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344]
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGGYFQNACPIRMSYVLNATGFPIARNSPYAKVSG
ADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCH
LLNDPDNGPFVPEVGTLWILP
 
Nucleotide Sequence: 486 bp     [Download]
>gi|378697983|ref|NC_016810.1|:317659-318144 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344, complete genome
ATGAACAGACCTTCATTCAATGAAGCGTGGTTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGG
GTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTGGTTATTTTCAAAATGCCTGCCCTATTCG
AATGAGCTATGTTTTGAATGCGACAGGGTTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGT
GCCGATAATAAATTCTATATTTATCGCGTGAATGATATGATTGATTATCTTACTCATACTATGGGCAAGC
CTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATCGGGAAGAAAGGAATTATCGTAGTAAAAGG
GCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTATCTGTTCAGATCAGTGCCAC
TTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACACTGTGGATACTGCCGTGA