SecReT6
Protein ID: 378711738
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0926
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]969180..970556 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDE8Y7A5
KEGG IDeko:EKO11_0926, ekf:KO11_08730
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.00E-48, Aligned region: 117..127
DUF3702 [PF12486], Evalue: 3.00E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 2.00E-15, Aligned region: 42..100
ImpA-rel_N [PF06812], Evalue: 2.00E-15, Aligned region: 358..376
Protein Sequence: 458 a.a.     [Download]
>gi|378711738|ref|YP_005276631.1| ImpA domain-containing protein [Escherichia coli KO11FL]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRRVEKLSLALFRQNGVELQTQVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
SAIETTLQQCELWHMTKLDVLAGQFRNTALRLERLAPQGAETTITPPELPRREMKQPEKSEESPQPVFAT
RPAQQNDKDASPSAPSPEISRQRTWPIFMAGMVVMACLGGTGLWGWSQLNQPDALIQRIQLSVMPLPQSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSTEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c970556-969180 Escherichia coli KO11FL chromosome, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACTTATAAGGAATCCG
GTGAACTACAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGACCTGATGTGGACTGGCGTCGGGTGGA
AAAACTCAGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAATTACAGACGCAGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGACATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGTTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATTTACCGTTGTGTACAGCATCTT
TCCGCCATCGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAACTGGATGTGCTGGCCGGGC
AGTTTCGTAATACGGCGCTACGTCTGGAGCGGCTGGCACCACAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAAGCAACCAGAAAAGTCAGAAGAAAGTCCACAGCCGGTTTTTGCAACC
AGACCCGCTCAGCAAAACGATAAGGATGCCAGTCCATCCGCGCCATCCCCTGAAATCTCCCGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCTGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCACTAATCCAGCGAATACAACTGTCTGTCATGCCATTACCGCAGTCGCTG
GAGAGCGGCGAGCTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAGGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGAGCGCTGAACGCGCAGTGGCGTAAA
CAGCGGGAGCTGAGCGCCCTGTCCACAGAGGCATTGAATGGCTACGCACAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAGCGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCGACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGCTGA
ATCGCTATGTAATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA