SecReT6
Protein ID: 378711741
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0929
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]971505..972584 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDE8Y7A8
KEGG IDekf:KO11_08745, eko:EKO11_0929
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.20E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|378711741|ref|YP_005276634.1| type VI secretion protein [Escherichia coli KO11FL]
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQNAPLGSTDNPATDAVRFRPHPGMGFPVSELKNV
ERDAGNPDVPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAMDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPALSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c972584-971505 Escherichia coli KO11FL chromosome, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGAGCCAGCAGAACGCGCCGCTGGGCAGTACCGACAACCC
CGCCACCGATGCGGTGCGCTTTCGTCCCCATCCCGGAATGGGCTTTCCGGTCAGCGAGTTAAAGAACGTT
GAACGTGACGCGGGCAATCCCGACGTGCCACCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGG
ATTCGCCGCTGCCAACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCTATGGATGACATTTCCCGTTGTCTGCTGGGACTCATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCGGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
GACGCGCACGGCGGAAGGCGTCACGGCACTGGTGGGACTGCTTGCCCCGCTGACGAAAGCGACGGTGGTG
CCTCACGATCCGCAGCCTGTTATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGCACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTACCTGGCGGGCAGCTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGCGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTATCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA