SecReT6
Protein ID: 378711742
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0930
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]972548..974308 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDE8Y7A9
KEGG IDeko:EKO11_0930, ekf:KO11_08750
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-182, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|378711742|ref|YP_005276635.1| type VI secretion protein [Escherichia coli KO11FL]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGSLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLSDFQVLSRPVGERRTRCFYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFECGPLVGDWSQIDLSRLPLYLNAGSPVACALHRALTLGTQQFWLRLPGQDR
RTLDAHFSPLGFEDNDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLELVAWPEGITGFEIDVVLNE
NWPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDADRMLEDETLSLSLTGTNGHLPR
KALQSTLLDRPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c974308-972548 Escherichia coli KO11FL chromosome, complete genome
ATGGACGACTTAACCCAACGCTACTACGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGGAAAGAATTTG
CGCAGGCTTACCCCGACCGCGCCGCGATGCTCAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
ACGCCTGTTCGAAGGCTTTGCTTTTTTAATGGGCAGCCTGCGCGAGAAGCTGGACGACGATCTGCCGGAG
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCTCACTACCTGCGAACTATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAGCGATTTTCAGGTATTGTCGCGCCC
TGTTGGCGAGCGCAGAACCCGCTGTTTCTACAGCGCCACGCGGGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGTTCGGTTATTCGTCTGCGCTTTGAATGCGGCCCGC
TGGTCGGTGACTGGTCACAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGGCAGTCCGGTGGC
CTGTGCGCTGCACCGGGCTTTAACGCTTGGTACGCAGCAGTTCTGGTTGCGTCTGCCGGGGCAGGATCGC
CGGACGCTTGACGCACACTTTTCCCCGTTGGGCTTTGAGGATAATGACAGGCTCTGGCCAAAAGGCGAGT
CGGCGTTCAGCGGCTACCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTTGTGGCACT
CAACGGGCTTGAGCTGGTTGCATGGCCGGAGGGGATAACCGGCTTTGAGATTGACGTGGTGCTGAACGAG
AACTGGCCTCACGACCTGCCGTTTGACAGCGATAATATCCGTCTGCACTGCGTGCCGGTCATCAATCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCACTGGAAAACGAATTTCTGCTACGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCG
TATGTCCCCTTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGTCTGCATGACACCTGGCTGATTCTGGGCGGTGATGCGTTTGA
TGCTGACCGGATGCTGGAGGATGAAACGCTCTCTTTAAGCCTGACCGGTACTAACGGGCATCTTCCCCGT
AAGGCTTTACAGAGCACGCTGCTCGATAGGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCCCCAACGCAGCCCTGCTATCCCCCGGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGCCACCT
TGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGAACGCTGGCGCTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTTTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCTACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA