SecReT6
Protein ID: 378711747
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0938
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]980428..981345 [-]
Producthypothetical protein
NotePAAR
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.70E-11, Aligned region: 9..66
Protein Sequence: 305 a.a.     [Download]
>gi|378711747|ref|YP_005276640.1| hypothetical protein [Escherichia coli KO11FL]
MGRGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRVTCGRYPGMFIIVGGVPETDIHGRLMAGTLD
SQSSCPCKARFIASMMDDTYETKEGSGTDNQIAGIDQNRLNKEWTDVRGDNTQKKTKYTSEIILITSTIR
VYSTNAEVMGDHSAIYFEVSGDSSSPYLYDPNGSYNPYKKLENGNGQRGSGFVFSGEFAKLDDFISYQEN
PNEVTQNKLDSEWFPYKVKLLSLPVTNDELLTIKNAALALDDGDEEPGSFSCAEWSSKLLKYIIPELDIY
TLPNSLWEAVVKEKEKRIKLNGENK
 
Nucleotide Sequence: 918 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c981345-980428 Escherichia coli KO11FL chromosome, complete genome
ATGGGAAGAGGCTATTTTCTGGTCAGGGGCGATAAGACCACCTGCGGCGGGAAGATTATTGAAGGCGCGG
ACGACCATACGATCATGGGTATCCCACAGGCACGGGATATGGACCGGGTCACCTGCGGCAGATATCCGGG
AATGTTTATTATTGTGGGCGGCGTTCCTGAAACAGATATTCACGGCAGGCTGATGGCGGGGACGCTGGAC
AGTCAGAGCAGTTGCCCGTGTAAGGCGCGATTTATTGCGTCAATGATGGATGATACGTATGAGACCAAAG
AAGGTTCAGGAACAGATAACCAGATAGCAGGAATAGATCAGAATAGGTTAAATAAAGAATGGACGGATGT
TCGAGGAGATAACACTCAGAAAAAAACAAAATATACATCAGAAATAATTTTAATTACATCCACAATTAGA
GTATATAGTACTAATGCCGAGGTAATGGGAGATCATTCAGCTATTTATTTTGAAGTGTCTGGTGATTCAT
CAAGCCCTTATCTTTATGATCCTAATGGAAGCTATAATCCTTATAAAAAATTAGAAAATGGAAATGGGCA
GAGAGGATCCGGTTTTGTATTTAGTGGTGAATTTGCAAAACTGGATGATTTTATCAGTTATCAAGAAAAT
CCGAATGAAGTAACGCAGAACAAGCTGGATAGCGAATGGTTTCCCTATAAGGTAAAGTTATTATCTTTAC
CGGTAACGAATGACGAGTTATTAACGATAAAGAATGCTGCATTGGCATTAGATGATGGCGATGAAGAACC
GGGGAGTTTTAGTTGTGCCGAATGGTCTTCAAAATTGTTAAAATATATAATCCCAGAACTTGATATTTAT
ACGCTGCCAAATTCACTATGGGAAGCGGTTGTTAAAGAAAAAGAAAAAAGAATAAAGTTAAATGGCGAGA
ATAAATGA