SecReT6
Protein ID: 378711748
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0939
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]981351..982988 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDE8Y7B5
KEGG IDekf:KO11_08810, eko:EKO11_0939
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-20, Aligned region: 75..135
Protein Sequence: 545 a.a.     [Download]
>gi|378711748|ref|YP_005276641.1| type VI secretion-associated protein [Escherichia coli KO11FL]
MRKNTGKTPMSELLQKLTRSCFVDRDALDVARTQAALWQTWLLPVTANTPVGEDPGYHDDFLRIRDEMNK
LSGADTDLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLAGLVERFGTQLLPSRPASRK
MALEWLAGEKMLDSLARYPEVAKEDFANIVAALNQLTVSFAAWPEEQQSPSLMPLINALESRLAQSGGMN
AVVPQNSSSIPAASSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPD
VDGKTRLVPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAV
IRQDLALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEA
LEMADSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPE
LLFEVKARQLKLLRLRAHRYADKALLNRKMEILLGTLVTIDPVRAAVLCDTQHKE
 
Nucleotide Sequence: 1638 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c982988-981351 Escherichia coli KO11FL chromosome, complete genome
ATGCGGAAGAATACGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGTCG
ACCGGGATGCACTGGATGTGGCGCGAACACAGGCAGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGC
AAATACGCCGGTCGGGGAAGACCCCGGCTACCACGACGATTTCCTGCGTATCCGCGACGAGATGAACAAA
CTTTCCGGCGCGGATACGGACCTCATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCAAAAGACG
TGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAGGGGCT
GGCGCTGCTGGCCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAAA
ATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAG
AGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGAACA
ACAGTCTCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCGCGTCTGGCGCAGTCGGGTGGGATGAAC
GCGGTGGTGCCGCAAAACAGCAGCAGCATACCTGCAGCGTCATCCCCGGTGGATGCGCCACAGGTACAGA
CCATCACCTCCGGGCGCGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCA
GGGCTGGCTTTCGGCGCACCGGCTGATGAAAACCCTGCGCTGGGATACGGTGCATGAACTGCCGCCGGAT
GTGGACGGCAAAACCCGGCTGGTCCCGCCGCGCACCGAGTCACGCAATCAGCTTAAGCGGCTGTATGCCC
AGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACTGGCGTCAGCCATTTCTGGCT
GGACATTCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCGGTT
ATCCGTCAGGACCTGGCGCTTCTGCTGGAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGCA
CACCGTTCGCCGACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATG
GCTTGCGGGGAAAGCCGCTGTGCCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCA
CTGGAGATGGCAGACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCA
CTGCACGACAGCGCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAGAT
GGCGCTCCTGCTGCTGGAAGAACTGGATACTGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCGGAA
CTGCTGTTTGAGGTAAAAGCCCGGCAACTGAAACTGCTGCGCCTGCGGGCGCACCGCTATGCTGATAAAG
CCCTGCTGAACCGAAAAATGGAAATCCTGCTGGGAACGCTGGTAACAATCGATCCGGTACGGGCAGCGGT
ACTGTGTGATACGCAGCATAAGGAGTGA