SecReT6
Protein ID: 378711752
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0944
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]988810..991317 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDE8Y7B9
KEGG IDekf:KO11_08835, eko:EKO11_0944
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.50E-62, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 1.50E-46, Aligned region: 602..743
T6SS_Vgr [PF13296], Evalue: 7.20E-35, Aligned region: 480..584
Phage_base_V [PF04717], Evalue: 3.40E-14, Aligned region: 392..473
Protein Sequence: 835 a.a.     [Download]
>gi|378711752|ref|YP_005276645.1| Rhs element Vgr protein [Escherichia coli KO11FL]
MDILVFDHSYHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAITPELVLMQDGAFSLTAPPVQ
GMPVQAPLRTLYGVITGFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIYQNQTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLHDGATEAVWGLNTAYRVVEKSVSTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDNEAAESGAFYARIRHERYLNEQAILKGLSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQ
VREMAPAMAILDGAQSQMQSLSTDAQTTNADPADLSSQIALLQQSVKDLTQAVILLSAPKGVAIASGEHL
QLAASKNVIANAGNNADIGVVKNMFIGVGQALSVFVRKAGIKLFANKGAVSVQAQNDLMELLAQKSIEIT
STEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELMAFPVIKSEDFNQ
SFILLDENTGQPLINWPYELELESGLKMSGITDENGNTELISSDKEEVVNISVFEPDEFLDDDIN
 
Nucleotide Sequence: 2508 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c991317-988810 Escherichia coli KO11FL chromosome, complete genome
ATGGACATACTTGTTTTTGACCACTCGTACCACAAACTCAAAATCCGCGGCCTGCAAAGTCCGGTGGATG
TGCTGACCTTCGAAGGCCGCGAACAACTGAGTACCCCGTTCCGCTACGACATTCAGTTTACCAGTACCGA
TAAAGCCATCACGCCGGAGTTGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCGGTACAG
GGAATGCCGGTGCAGGCACCCCTGCGCACCCTGTACGGCGTCATCACCGGCTTTAAACATCTCTCATCGT
CACAGGACGAAGCCCGTTACGAAGTACGGCTTGAACCCCGTATGGCGCTGCTGACCCGCAGCCGCCAGAA
TGCCATTTACCAGAACCAGACTGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTATGGCGAGG
ACGACCTGACGTTTGTCTCGCGCCTGCTGTCAGAAGTGGGTATCTGGTTCCGCTTCGCCACCGATGCCCG
GCTGAAAATTGAGGTTATCGAGTTTTACGACGACCAGAGCGGCTATGAGCGCGGACTGACGCTGCCGCTT
CGCCATCCTTCAGGGTTACACGACGGCGCCACGGAAGCGGTATGGGGACTGAACACCGCGTACAGGGTGG
TGGAAAAAAGCGTCTCCACGCGGGACTACAACTACCGCACCGCCACAGCGGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCTGACAACTTCCTGCAAAAA
GGCGATAACGAGGCAGCGGAAAGCGGCGCGTTTTACGCCCGTATCCGCCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCTGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCTGCGGTATTCCGCAAGGGCGTGCTGATTACCGGCGTGACGGCCAGCGCGGCGCGTGACCGC
AGCTATGAACTGACGTTCACGGCCATACCCTACTCAGAACGCTACGGCTACCGCCCGGCGCTTATCCCCC
GCCCGGTAATGGCCGGCACGCTCCCGGCGCGGGTCACCAGCACAGTGAAGAACGATATTTATGCTCATAT
CGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCGGGAGACACCTACGGCCTGCATCTGCCGCTGCTGGCGGGAA
CGGAAGTCAGCATCGCGTTTGAGGAAGGCAACCCGGACCGACCTTATATCGCAGGCGTAAAACACGACTC
GGCGCACACCGACCATGTGACCATCCAGAACTACAAGCGCAACGTGCTGCGTACCCCGGCGAACAACAAA
ATCCGCCTCGATGATGAGCGCGGCAAAGAGCATATCAAGGTCAGTACCGAGTACGGCGGCAAGAGCCAGT
TGAATCTGGGTCATCTGGTGGATGCCGGAAAACAACAGCGCGGGGAAGGCTTTGAACTGCGTACCGATAT
GTGGGGCGCGGTGCGGGCGAAGAAAGGGATTTTTATCAGCGCCGATGCGCAGGATAAGGCGCAGGGGCAG
GTGCGCGAAATGGCTCCGGCGATGGCAATACTGGATGGCGCACAGTCACAGATGCAGTCGCTGTCCACTG
ATGCGCAGACGACGAATGCCGATCCGGCAGATCTGTCATCGCAGATAGCGCTGTTGCAGCAAAGTGTAAA
AGATCTGACGCAGGCCGTGATCCTGCTAAGTGCACCCAAGGGCGTGGCGATCGCCAGCGGCGAGCACCTG
CAACTGGCGGCGTCGAAGAATGTGATAGCGAACGCAGGCAACAACGCAGATATCGGCGTAGTAAAAAATA
TGTTTATCGGTGTGGGTCAGGCGCTGAGCGTGTTTGTGCGTAAAGCGGGCATCAAGCTGTTTGCCAATAA
AGGGGCGGTCTCGGTACAGGCACAGAACGATCTGATGGAACTGTTGGCACAGAAATCGATAGAGATCACC
AGTACGGAAGATGAGATCAAGATCACCGCGAAGAAGAAAATCACCCTTAACGGCGGTGGCAGCTACATCC
GGCTGGATGCCTGCGGGATAGAAGCGGGAACGCCGGGAGAATATAACGTTAAGGCCGGATATTACGGGCG
TAAACCAAAGGCGAAGCTGACGCCGGAGCTGATGGCATTTCCGGTGATTAAGTCTGAGGATTTTAATCAG
AGCTTTATTTTGCTGGATGAAAATACTGGGCAACCACTTATTAATTGGCCCTATGAACTAGAACTGGAAA
GTGGGCTAAAAATGAGTGGGATTACTGATGAAAATGGAAATACAGAACTAATATCCTCTGATAAGGAGGA
GGTCGTTAATATTAGTGTGTTTGAACCCGATGAGTTTTTAGACGATGACATTAATTAA