SecReT6
Protein ID: 378711755
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0947
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]993021..995507 [-]
ProductRhs element Vgr protein
NoteTssI
UniProt IDE8Y7C2
KEGG IDekf:KO11_08850, eko:EKO11_0947
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.30E-61, Aligned region: 30..347
DUF2345 [PF10106], Evalue: 3.30E-46, Aligned region: 606..743
T6SS_Vgr [PF13296], Evalue: 1.70E-33, Aligned region: 480..585
Phage_base_V [PF04717], Evalue: 3.50E-14, Aligned region: 392..473
Protein Sequence: 828 a.a.     [Download]
>gi|378711755|ref|YP_005276648.1| Rhs element Vgr protein [Escherichia coli KO11FL]
MGIQNFDHSHHKLKIRGQQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAITPELVLMQDGAFSLTAPPVQ
GMPVQAPLRTLYGVITGFKHLSSSQDEARYEVRLEPRMALLARSRQNAIYQNLTVPQIVEKILRERHQMR
GQDFVFNLKSEYPAREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVIEFYDDQSGYERGLTLPL
RHPSGLHDGATEAVWGLNTAYRVVEKSVSTRDYNYRTATAEMMTEQHDATGGDNTTYGEAYHYADNFLQK
GDNEAAESGAFYARIRHERYLNEQAILKGLSTSSLLMPGLEIRVQGDDAPAVFRKGVLITGVTASAARDR
SYELTFTAIPYSERYGYRPALIPRPVMAGTLPARVTSTVKNDIYAHIDKDGRYRVNLDFDRDTWKPGYES
LWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRPYIAGVKHDSAHTDHVTIQNYKRNVLRTPANNK
IRLDDERGKEHIKVSTEYGGKSQLNLGHLVDAGKQQRGEGFELRTDMWGAVRAKKGIFISADAQDKAQGQ
VREMADIISELNGLSDKIQKLSDDATMANADPADMAAQIALITSRINDLTAPVILMHAPKGVAVASGEHL
QLAAVKNLQINAGNNADIGVVKNMFIGVGRALSVFVRKAGIKLIANKGAVSVQAQHDLMELLAKKSIEIV
STEDEIRISAKKKITINGGGSYIRIEGSGIEPGTPGDYNVKAVHYGRQPGAKLKQEMMAFPMIESGEFNT
RFFFTDDNDIPYANTKYIARLPDGTTKDGITSDDGRSEIFFSDKDGEILIHLFVEQDK
 
Nucleotide Sequence: 2487 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c995507-993021 Escherichia coli KO11FL chromosome, complete genome
ATGGGTATTCAGAATTTCGACCACTCGCACCACAAGCTCAAAATTCGCGGCCAGCAAAGTCCGGTGGATG
TGCTGACCTTTGAAGGCCGCGAGCAACTGAGTACCCCGTTCCGCTACGATATCCAGTTTACCAGTACCGA
TAAAGCCATCACGCCGGAGTTGGTGCTGATGCAGGACGGCGCATTCAGCCTGACGGCACCGCCGGTACAG
GGAATGCCGGTGCAGGCCCCCCTGCGCACCCTGTACGGGGTCATTACCGGTTTTAAACATCTCTCATCGT
CACAGGACGAAGCCCGTTACGAAGTACGGCTGGAGCCGCGTATGGCGCTGCTGGCCCGCAGCCGCCAGAA
TGCCATCTACCAGAATCTGACGGTGCCGCAAATCGTCGAAAAAATCCTGCGCGAGCGGCACCAGATGCGC
GGTCAGGACTTCGTGTTTAACCTCAAAAGCGAATACCCGGCCCGCGAACAGGTGATGCAGTATGGCGAGG
ACGACCTGACGTTTGTCTCGCGCCTGCTGTCAGAAGTGGGTATCTGGTTCCGCTTCGCCACCGATGCCCG
GCTGAAAATTGAGGTTATCGAGTTTTACGACGACCAGAGCGGCTATGAGCGCGGACTGACGCTGCCGCTT
CGCCATCCTTCAGGGTTACACGACGGCGCCACGGAAGCGGTATGGGGACTGAACACCGCGTACAGGGTGG
TGGAAAAAAGCGTCTCCACGCGGGACTACAACTACCGCACCGCCACAGCGGAGATGATGACAGAGCAGCA
TGACGCCACCGGGGGCGATAACACCACCTACGGCGAAGCCTACCACTATGCTGACAACTTCCTGCAAAAA
GGCGATAACGAGGCAGCGGAAAGCGGCGCGTTTTACGCCCGTATCCGCCACGAACGCTACCTGAATGAAC
AGGCCATTCTCAAAGGCCTGAGCACCAGTTCACTGCTGATGCCGGGGCTGGAAATCAGGGTTCAGGGCGA
CGACGCGCCTGCGGTATTCCGCAAGGGCGTGCTGATTACCGGCGTGACGGCCAGCGCGGCGCGTGACCGC
AGCTATGAACTGACGTTCACGGCCATACCCTACTCAGAACGCTACGGCTACCGCCCGGCGCTTATCCCCC
GCCCGGTAATGGCCGGCACGCTCCCGGCGCGGGTCACCAGCACAGTGAAGAACGATATTTATGCTCATAT
CGACAAGGACGGGCGCTACCGGGTCAACCTCGACTTTGACCGCGATACGTGGAAACCGGGTTATGAAAGC
CTGTGGGTACGCCAGTCGCGCCCGTATGCCGGTGACACCTACGGCCTGCATCTGCCGCTGCTGGCGGGAA
CGGAAGTCAGCATCGCCTTTGAGGAAGGCAACCCGGACCGACCTTATATTGCAGGCGTAAAACACGACTC
GGCACACACTGACCATGTGACCATCCAGAACTACAAGCGCAACGTTCTGCGCACCCCTGCCAATAACAAA
ATCCGGCTGGATGATGAGCGCGGTAAAGAGCATATCAAGGTCAGTACCGAATATGGCGGCAAGAGCCAGC
TAAACCTCGGTCATCTTGTTGATGCCGGGAAACAGCAGCGCGGGGAAGGCTTTGAACTGCGTACCGATAT
GTGGGGTGCGGTGCGGGCAAAGAAAGGCATCTTTATCAGCGCCGATGCGCAGGATAAGGCGCAGGGTCAG
GTCAGAGAGATGGCCGACATTATCAGCGAACTGAACGGCCTGAGCGATAAAATCCAGAAACTGTCCGATG
ACGCGACGATGGCGAACGCCGACCCGGCGGATATGGCCGCGCAGATAGCATTGATAACCAGCCGGATAAA
CGACCTGACCGCCCCGGTGATTTTGATGCACGCGCCGAAAGGTGTGGCGGTCGCCAGCGGCGAGCACCTG
CAACTGGCAGCGGTGAAAAACCTCCAGATAAATGCGGGAAACAACGCCGATATCGGCGTGGTGAAGAATA
TGTTTATCGGCGTGGGGCGGGCGCTGAGCGTGTTTGTGCGCAAGGCGGGTATCAAACTGATTGCCAATAA
AGGCGCAGTATCGGTACAGGCGCAGCACGATTTGATGGAGTTACTGGCGAAGAAGTCGATAGAGATCGTC
AGTACCGAAGATGAGATCAGGATTTCAGCGAAGAAAAAAATAACGATTAATGGCGGTGGAAGTTATATCC
GGATTGAGGGTAGCGGCATTGAGCCAGGAACGCCGGGGGATTATAACGTCAAAGCGGTGCATTATGGGCG
TCAGCCGGGAGCGAAGCTGAAACAGGAAATGATGGCGTTTCCGATGATTGAATCTGGAGAATTTAATACC
CGTTTCTTTTTTACAGATGATAATGATATTCCTTATGCAAACACCAAATATATAGCAAGATTACCAGATG
GTACAACAAAAGACGGCATTACAAGCGATGATGGTCGATCAGAAATATTTTTTTCTGATAAGGATGGGGA
AATATTAATACATCTATTTGTCGAGCAGGATAAATAA