SecReT6
Protein ID: 378711758
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0950
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]998904..1000556 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDE8Y7C5
KEGG IDekf:KO11_08865, eko:EKO11_0950
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.10E-17, Aligned region: 437..533
Protein Sequence: 550 a.a.     [Download]
>gi|378711758|ref|YP_005276651.1| OmpA/MotB domain-containing protein [Escherichia coli KO11FL]
MRNTLKQAVVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTGDAGLSSLPPE
TYRQPVVLVCGDMSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTLRPAWASQLAVAYTVMPGMYR
DAAVLTGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPLPEKAHSPWLICTGGEIQVATSAETASPAQW
LTQTSTQERSQPLCYLLKAESLMQWLNLYVLAALNGPEAKCPPLAMAVGLHPSLPAVDNNLWQLWITART
GLTTDIADTGTDATLPFPDALLRRLPRQSGFTPLRRASVTMLGITTVAGIAALCLSATANHQLLRHIGDD
LHQFYAVPAEEFITKARRLSVLKDDAVMLDGYYREGEPLRLGLGLYPGEQIRQPVLRAIRDWRPPEQKME
VTASLQAQTVRLDSMSLFDVGQARLKDGSTKVLVDTLVNIRAKPGWLILVAGYTDATGDEKSNQQLSLRR
AEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLVPRSDACQDVK
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c1000556-998904 Escherichia coli KO11FL chromosome, complete genome
GTGAGGAACACGCTGAAACAGGCCGTCGTGCTGTGGGGAATGGTGTTACTGCTGGTGCTGTGGTCGGTGT
TTATCAGTCCGTCTGGCGTACTGAGATGGGCCGGGGCGGCGGCTATCGTTCTGGCGGTTGCCGCGTTGCT
GATTTACCGGCGCAGGCAGGCGTGGACGGAGATGACCGGCGATGCCGGGTTGTCATCGCTGCCGCCGGAA
ACGTACCGACAACCGGTAGTGCTGGTCTGTGGCGATATGTCGGCGCATCTGTTCACTGACAGCCCGGTCC
GGCAGGTTTCAGAAGGGCTGTATCTGCATGTTCCCGATGAAGAACAGCTTGTGGCGCAGGTGGAGCGATT
ACTGACCCTTCGCCCGGCGTGGGCATCGCAGCTTGCCGTGGCGTATACCGTCATGCCCGGCATGTACCGG
GATGCGGCGGTTCTGACCGGACGACTGCGACGGTTCGCCCACAGTATGGCGACAGTGCGTCGCCGGGCGG
GCGTAAACGTCCCCTGGCTTCTCTGGAGCGGGCTGTCCGGCTCGCCCTTGCCGGAGAAGGCACATTCACC
GTGGCTTATCTGTACCGGCGGCGAAATTCAGGTAGCGACGTCTGCTGAAACCGCCTCCCCCGCGCAGTGG
CTCACGCAGACCAGCACACAGGAGCGCAGCCAGCCACTCTGTTACCTGCTGAAAGCCGAAAGCCTGATGC
AGTGGCTGAATCTTTATGTGCTGGCGGCACTGAACGGCCCGGAGGCGAAATGCCCGCCACTGGCGATGGC
CGTGGGGCTACACCCCTCGTTGCCTGCAGTGGATAACAACCTGTGGCAGCTGTGGATCACCGCCAGAACC
GGCCTGACGACGGATATCGCGGACACCGGCACAGACGCCACGCTGCCGTTTCCGGATGCCCTGTTACGGC
GGTTGCCGCGTCAGTCGGGCTTTACCCCGCTGCGACGGGCCAGTGTAACCATGCTGGGCATCACCACCGT
GGCGGGTATCGCCGCGCTGTGTCTGTCAGCCACGGCGAATCACCAGTTATTACGGCATATCGGTGACGAT
CTGCACCAGTTTTATGCCGTTCCGGCGGAGGAATTTATCACCAAAGCCCGTCGTCTGTCGGTGCTGAAAG
ACGATGCGGTCATGCTCGATGGGTATTACCGGGAAGGAGAACCGCTGCGTCTCGGTCTGGGGTTATACCC
CGGCGAACAAATCCGCCAGCCGGTATTACGCGCCATTCGTGACTGGCGTCCGCCTGAGCAAAAAATGGAA
GTGACAGCCTCGCTTCAGGCGCAGACCGTGCGTCTTGACAGTATGTCGCTGTTTGACGTCGGACAGGCCC
GCCTGAAAGACGGCTCGACAAAAGTGCTGGTGGACACACTGGTGAACATCCGGGCAAAACCGGGCTGGCT
TATCCTCGTGGCCGGATATACCGACGCCACCGGCGACGAAAAAAGCAATCAGCAGTTATCACTGCGACGT
GCCGAAGCGGTGCGTAACTGGATGCTGCAGACCAGCGACATCCCGGCCACCTGTTTTGCCGTACAGGGAC
TGGGTGAGAGCCAGCCTGCGGCGACCAACGATACGCCACAGGGCCGGGCAGTCAACCGGCGCGTCGAAAT
CAGTCTTGTTCCGCGTTCTGACGCCTGTCAGGACGTGAAATAA