SecReT6
Protein ID: 378711760
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0952
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]1001231..1002568 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDE8Y7C7
KEGG IDekf:KO11_08875, eko:EKO11_0952
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.70E-131, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|378711760|ref|YP_005276653.1| type VI secretion protein [Escherichia coli KO11FL]
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDSIAQLCIRHPWGIANVLFDRDALMSGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLHALTNDSAVVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSTVFPPLFSLLSELLEASLPSRVIALELGSLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVSLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGCCMIYAPGTMGDLKPELFAVLRA
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c1002568-1001231 Escherichia coli KO11FL chromosome, complete genome
ATGAAAATTCATCGACCACTGTGGGCTGAGGGGACATTCCTGTCCTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACAGCATTGCGCAACTTTGTATTCGTCATCCGTGGGGGATCGCGAATGT
GCTCTTTGACCGCGATGCCCTGATGTCCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGCACGCTGATCGATTCTGACGTGAGCGATGTTCTGCCTCTCGCCTGCGATCTGCACGCGCTGACGAACG
ACAGCGCGGTTGTTCTGCTGGCGCTGCCGCTTGCCCATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTACGCTATCGTCAGGAATGGCAAAAGGTACAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGAGTTATATTCCGCCGTT
ACTGGCGTTTAACGCCCATGACGGACTGGTACAGCGTCTGGACACGCTGCTGTTGCAGCTACGGGCCAAA
TGTCAGCGCCTGATGGCGATGCGTCGGGAAAGCAACCAGCGTATGGCGGACTTCGCCGTCGCCGATGTCT
CCCTGTTCTGGTTGCTTAACGCGCTGAACTCCGCCGAGCCGGTGCTGAGTGATTTCCTGCGCTACCCGGC
GGTTCACCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGGGCGCTGCTGACATTTTCCCTTGAA
CATAACGTCAGCGCCGTCCCGCCCTATGTCCACGAATCGCCGTCCACCGTCTTTCCGCCCCTGTTCTCCC
TGCTCAGCGAACTGCTGGAAGCCAGCCTGCCGTCACGGGTGATCGCACTGGAGCTGGGATCCCTGCCGGG
CAACCGCTGGAAAGCAGACCTGCACGATCCGCGCCTGCGGGAAGAGGCCGATTTTTATCTGTCCGTTCGT
TCCTCTCTGCCTGCGCATCAGGTACTGCACCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCTGATGACG
TCACGCTGCTTATCAACGTGGCGCTGAACGGTGTTTCACTGGTGCCACTGACCTCAGTTCCGGCGGCGCT
GCCGCTGCGACTGGAGAACCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGTGCTGCATGATTTATGCGCCAGGAACCATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCGCATGA