SecReT6
Protein ID: 378711761
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0953
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]1002586..1004124 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDE8Y7C8
KEGG IDekf:KO11_08880, eko:EKO11_0953
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|378711761|ref|YP_005276654.1| type VI secretion protein EvpB [Escherichia coli KO11FL]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLLSC
LAKSGENVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDI
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFSNLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c1004124-1002586 Escherichia coli KO11FL chromosome, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTGACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTTGATAAAATTAATTTAACCCCGGTGTCTTCCATTCAGGAAATAGATTTATGGCAAAA
CAGCGAAACACTGGCGGATGCCTCACCCGATGAGCGCGTGACAGCGGCGATTCACGTTCTACTTTCCTGT
CTGGCGAAATCAGGCGAGAACGTGGTCAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACGATTTGG
ATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCATCCTGAATTCCAGAAAGTCGAGTCGCTGTG
GCGCGGCACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTGGATATC
AGCAAAGAGCATCTGCGTCAGGATTTCGACGACTCCCCGGAAATCATTCAGAGCGGTTTATATCGTCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTTGCCTCATTAATTTCCAGCTATGAATTTGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGCAATATTTCCAGAGTGTCTGCCGCTTCCCATATGCCTTTT
ATCGGTTCTGTCGGGCCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAGATATCG
GCAACTACTTTGACCGCGCAGAATATATTAAATGGAAATCGTTTCGTGATACCGATGACAGCCGCTATGT
GGGATTAGTGATGCCGCGAGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAGTATCTCTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGTCCACAAGCAGGTGG
CGCAGTGGCCGATCTGCCCATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTTCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCGGCAAACTCTGCCCAGAAACCGGCGTTGTATGATACCGCTGACGC
CACCGCCAACAGCCGTATTAACGCCCGTCTGCCCTATATCTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATCATCCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAACTGAACACCT
GGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCTGCGCGA
CGGTAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATTGAAGGGATGGATATCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCGAAAGCCTGA