SecReT6
Protein ID: 378711762
SecReT6 ID555
T6SS typei2
Gene symbol-
Locus tagEKO11_0954
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]1004183..1004683 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDE8Y7C9
KEGG IDekf:KO11_08885, eko:EKO11_0954
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.90E-52, Aligned region: 6..158
Protein Sequence: 166 a.a.     [Download]
>gi|378711762|ref|YP_005276655.1| type VI secretion protein [Escherichia coli KO11FL] [TssB]
MADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSERDKIDINKNNFNSVMAEF
SPAVNLTVEDTLSGSGNEQNIALEFKSLKDFEPEQVAKNIPQLRVLLAMRNLLRDLKSNLLDNATFRREL
ENILKDPTLSSELRDELAKIAPQENV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|378710836|ref|NC_016902.1|:c1004683-1004183 Escherichia coli KO11FL, complete sequence [TssB]
ATGGCCGACAGTTTCCAGAATGAAGTTCCCGCCGCTCGTGTAAATATCAAGCTTGACCTGCATACAGGCA
ATGCTAAAAAGAAAGTTGAACTCCCCCTCAAGCTTCTTGCTGTTGGCGATTACAGTAACGGAAAAGAGCA
ACGTCCGCTGTCCGAACGGGACAAGATTGATATCAATAAAAACAACTTCAACAGTGTCATGGCTGAGTTT
TCGCCTGCGGTTAATTTAACAGTAGAAGACACACTAAGCGGAAGCGGTAATGAGCAAAATATCGCGCTTG
AATTTAAAAGCCTGAAAGATTTTGAACCCGAACAGGTAGCAAAAAATATCCCACAGCTTCGTGTATTACT
CGCTATGCGCAATTTATTACGTGACCTGAAATCCAATCTGTTAGATAACGCAACGTTTCGACGTGAACTG
GAAAATATCCTGAAAGACCCGACGCTCAGTTCAGAACTGCGTGATGAACTGGCGAAAATTGCGCCGCAGG
AGAACGTTTAA