SecReT6
Protein ID: 378714434
SecReT6 ID556
T6SS typei1
Gene symbol-
Locus tagEKO11_3690
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]3852123..3852347 [+]
Producthypothetical protein
NoteTssC
UniProt IDE8YBQ8
KEGG IDekf:KO11_01110, eko:EKO11_3690
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|378714434|ref|YP_005279327.1| hypothetical protein [Escherichia coli KO11FL]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|378710836|ref|NC_016902.1|:3852123-3852347 Escherichia coli KO11FL chromosome, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA