SecReT6
Protein ID: 378714441
SecReT6 ID556
T6SS typei1
Gene symbol-
Locus tagEKO11_3697
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]3859022..3860353 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDE8YBR5
KEGG IDeko:EKO11_3697, ekf:KO11_01075
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.10E-148, Aligned region: 20..442
Protein Sequence: 443 a.a.     [Download]
>gi|378714441|ref|YP_005279334.1| type VI secretion protein [Escherichia coli KO11FL]
MATTRNKVMWQEGMLMRPHHFQQQQRYNDYLDNQRFRAMNNLSWGFTELTLNNELLAQGKIMIDSASGTL
PDGTVFSIPDQDALPDPLHPQHFPDERSRNIYLALPVASDVRNEISDGRRIGRYRLNYADVRDLHSEEGD
TRTLTLGQLTPRIMSGAEDMSAYITLPLCRISDRHADGSLTLDDDFIPSCQNIQVSKKLRVYLKEVQGAI
GGRASDLANRIGSPAQSGIADVAEFMMLQLLNRNQTRFTHRARRSQLHPEDFYLDLAGLLGELMTFTEPS
RLPCPLDVYDHHDLTKTFKTLLPEVKRALHTVLSPRAVNLPLHLRDGIWQADIHDTELLQSATFVLAVAA
NMPVDQIQRQFIQQSKISSPEKIRNMVSVQIPGIPLRALMVAPRQLPYHSGFSYFELDKSGQAWTEMAAA
GAVALHVSGSFPDLNMQLWAIRG
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|378710836|ref|NC_016902.1|:3859022-3860353 Escherichia coli KO11FL chromosome, complete genome
ATGGCAACCACCCGCAACAAGGTGATGTGGCAGGAAGGGATGCTGATGCGTCCACACCATTTCCAGCAGC
AGCAGCGTTACAACGACTACCTGGATAACCAGCGTTTCCGGGCCATGAATAATTTATCCTGGGGATTTAC
CGAACTCACTCTCAACAATGAACTGCTGGCACAGGGTAAGATCATGATTGACAGCGCGTCAGGCACACTG
CCCGACGGCACCGTCTTTTCTATCCCCGACCAGGACGCACTGCCCGATCCGCTGCACCCGCAACATTTTC
CGGACGAGAGAAGCCGCAATATCTACCTCGCTCTGCCGGTCGCCAGTGATGTGAGAAATGAAATCAGCGA
CGGGCGGCGAATCGGGCGTTACCGGCTGAATTATGCCGATGTCCGGGATTTGCATTCAGAAGAAGGTGAC
ACGCGAACACTGACGCTGGGACAACTGACGCCGCGCATTATGAGCGGTGCAGAAGATATGAGCGCCTATA
TTACGCTCCCGCTTTGCCGTATCAGTGATCGCCATGCCGACGGCTCCCTGACGCTGGATGACGATTTTAT
CCCCTCCTGCCAGAATATTCAGGTCAGTAAGAAACTGCGTGTTTATCTCAAAGAGGTACAGGGGGCCATT
GGCGGACGGGCAAGCGATCTGGCAAACCGCATTGGCTCTCCGGCGCAGAGCGGCATCGCGGATGTGGCGG
AATTTATGATGTTGCAGTTACTTAACCGTAACCAGACCCGGTTTACCCATCGCGCTCGTCGATCCCAGCT
CCACCCGGAAGATTTCTACCTTGATCTTGCCGGGTTGCTGGGTGAACTGATGACCTTTACCGAGCCGTCG
CGCCTGCCCTGCCCGCTTGATGTGTATGATCATCATGACCTGACCAAAACATTTAAAACGCTGTTACCGG
AAGTCAAACGGGCGCTGCATACCGTACTGTCGCCAAGAGCCGTTAATCTGCCGCTGCATCTGCGTGACGG
TATCTGGCAGGCCGATATCCATGACACAGAACTGCTGCAATCTGCCACCTTTGTGCTGGCTGTGGCGGCA
AACATGCCGGTCGATCAGATCCAGCGCCAGTTTATCCAGCAGTCGAAAATTTCCTCGCCGGAAAAAATCC
GCAATATGGTCAGTGTGCAGATACCCGGCATTCCATTGCGTGCCCTGATGGTGGCTCCCCGCCAGCTTCC
TTACCATTCCGGGTTCAGCTATTTCGAACTCGACAAGAGCGGACAGGCCTGGACAGAAATGGCTGCCGCC
GGGGCCGTTGCACTGCATGTATCCGGCAGTTTCCCGGATCTGAACATGCAACTGTGGGCGATAAGAGGGT
AA