SecReT6
Protein ID: 378714445
SecReT6 ID556
T6SS typei1
Gene symbol-
Locus tagEKO11_3701
StrainEscherichia coli KO11FL
Repliconchromosome [GenBank: NC_016902] [Browse all T6SS(s) in this replicon]
Location [Strand]3864680..3866092 [+]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDE8YBR9
KEGG IDeko:EKO11_3701, ekf:KO11_01055
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 6.20E-09, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 6.20E-09, Aligned region: 152..184
Protein Sequence: 470 a.a.     [Download]
>gi|378714445|ref|YP_005279338.1| type VI secretion-associated protein [Escherichia coli KO11FL]
MAMDLRDPNVWVSHLLENLPEEKLASALKDDNPNWEYIDGEIVKLGSLAHSQLDIPELQRRGLVILASES
KDFRLLAHLLRTLQHAGDPHLALRLLALYVEHYWAVAAPQNMAHKKRFASQVIKRFETGIEVFSQNAATA
QRDALSGELAKLAQCWQSHNAPELAQATDDLFALYQRAFNRAAPAPVPTPAASGSSPQTTATSESGVTQP
SAPAPQIVIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQNITSTPQAESDGRTPLAAVSAD
MVADYHAQLGSADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADAIRDEVIRFLERLPQLTGL
LFNDHTPFISEQTKQWLAASPDAKVAPVAQIGEESKAARACFAEQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLVQLAQQQYRMLFRMGLQMMVADWEPSLLEQLEQKFTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|378710836|ref|NC_016902.1|:3864680-3866092 Escherichia coli KO11FL chromosome, complete genome
ATGGCAATGGACTTACGCGATCCGAATGTCTGGGTATCGCACCTGCTGGAAAACCTGCCGGAAGAGAAAC
TGGCATCGGCGCTGAAAGATGACAACCCGAACTGGGAGTATATCGACGGCGAAATCGTCAAGCTGGGATC
GCTGGCCCACAGTCAACTGGATATCCCGGAACTCCAGCGCCGGGGGCTGGTCATTCTGGCTTCGGAGAGT
AAGGATTTTCGTCTGCTGGCGCATCTGCTGAGAACCCTGCAACACGCCGGTGATCCTCATCTCGCATTGC
GCCTGCTGGCGCTGTATGTGGAGCATTACTGGGCGGTGGCTGCGCCGCAGAATATGGCGCATAAAAAACG
CTTTGCCAGCCAGGTCATTAAACGCTTTGAAACAGGTATTGAAGTTTTTTCACAGAACGCCGCCACAGCG
CAGCGCGATGCGCTGTCAGGGGAACTGGCAAAACTGGCGCAATGCTGGCAGTCACATAACGCCCCGGAAC
TGGCACAGGCTACTGATGATCTTTTTGCCCTGTACCAGCGTGCGTTTAATCGTGCGGCACCGGCTCCTGT
CCCCACTCCGGCGGCCTCCGGTAGTTCACCACAGACCACCGCCACGTCTGAAAGCGGCGTGACGCAACCC
AGTGCTCCGGCTCCCCAAATCGTCATCGACAGTCACGACGACAAAGCCTGGCGCGACACGCTGTTAAAAG
TGGCGGCCATTTTATGTGAACGCCAGCCGGATTCACCGCAGGGCTACCGTCTGCGCCGCCATGCGCTTTG
GCAGAACATCACCAGTACGCCCCAGGCGGAAAGCGATGGCCGTACTCCACTGGCTGCGGTCTCCGCCGAT
ATGGTGGCAGATTACCATGCTCAGCTCGGTAGTGCCGATATGGCGCTGTGGCAGCAGGTGGAGAAAAGCG
TACTGCTGGCTCCTTACTGGCTGGATGGTCACTGCCTTTCTGCACAGACGGCGCTGCGTCTGGGTTACAA
ACAGGTGGCAGACGCCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAGCTTACCGGGCTG
CTGTTTAATGACCACACACCGTTTATCAGTGAGCAGACGAAACAATGGCTGGCAGCTTCGCCCGACGCCA
AAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGAAGGCAGCCAGAGCCTGTTTTGCTGAGCAGGGTCT
GGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTTCACCGCCAGTAC
CTTGCCGCACAGTTGACGGAAGAGGCGGGGCTGGTACAGCTTGCGCAGCAGCAGTACCGGATGTTGTTCA
GGATGGGATTGCAGATGATGGTGGCAGACTGGGAGCCGTCCCTGCTTGAGCAGCTAGAACAAAAATTCAC
GGCAGAACAATAA