SecReT6
Protein ID: 378766689
SecReT6 ID536
T6SS typei3
Gene symbol-
Locus tagPANA5342_1722
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1820000..1820503 [+]
Producttype VI secretion system, core protein
NoteTssJ
UniProt IDG9AQS4
KEGG IDplf:PANA5342_1722
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.10E-27, Aligned region: 19..143
Protein Sequence: 167 a.a.     [Download]
>gi|378766689|ref|YP_005195152.1| type VI secretion system, core protein [Pantoea ananatis LMG 5342]
MAQTYFRVGLAKWIWPFLLLLLTACSSSKPDIARYNLHFQAHPSINSGAPLKVRVMLLTSDAEFMSADFF
TLQNQPATALGNTLLNNQQFFLMSGQLSKTLSAKSLPDARFIGIMAEYQKLDGKVWRLALPFPDSDSSSF
WQFWKSNDGELNANIIVDDAGMRPVKQ
 
Nucleotide Sequence: 504 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1820000-1820503 Pantoea ananatis LMG 5342, complete genome
ATGGCACAAACTTACTTTCGCGTTGGCCTGGCAAAATGGATCTGGCCCTTCCTGCTGCTTCTGCTAACGG
CATGCAGTAGCAGTAAGCCTGATATTGCGCGATACAACCTGCACTTCCAGGCACATCCTTCCATCAATTC
GGGCGCACCTCTCAAAGTCCGGGTGATGTTGCTGACGTCTGATGCAGAATTTATGTCCGCCGACTTCTTC
ACTCTGCAGAATCAACCCGCTACCGCACTGGGAAATACGCTGCTCAACAATCAGCAGTTTTTCCTGATGT
CCGGTCAGCTCAGTAAAACGCTGAGTGCCAAAAGCCTCCCCGACGCGCGCTTTATCGGCATCATGGCGGA
ATATCAAAAGCTGGATGGCAAGGTGTGGCGACTTGCGCTGCCTTTCCCAGACAGTGACAGCAGCTCGTTC
TGGCAGTTCTGGAAAAGCAATGATGGTGAGTTAAACGCCAACATTATCGTTGACGATGCCGGCATGCGTC
CCGTTAAGCAATAA