SecReT6
Protein ID: 378766690
SecReT6 ID536
T6SS typei3
Gene symbol-
Locus tagPANA5342_1723
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1820525..1821865 [+]
Producttype VI secretion system, core protein
NoteTssK
UniProt IDG9AQS5
KEGG IDplf:PANA5342_1723
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.40E-150, Aligned region: 19..442
Protein Sequence: 446 a.a.     [Download]
>gi|378766690|ref|YP_005195153.1| type VI secretion system, core protein [Pantoea ananatis LMG 5342]
MNRAEKVVWAEGMFLRPHHFQQAENFLQSSLREWGQSQRPYVWGFFDLEFDEALLRQGKLALSAASGCLP
DGTFFAFSQPQHGPAPLDVPSNTDRAKVVLAIPARRNGREAVTFQDAPDSLARYLAWEAEVEDDNAQAVG
TATVQFGKLRLRLMLEQDLTAEWTAMGVAQIVEKRSDNHIRLDNDYIPPTLTLAGSRPLQSMMTDLHGMI
QQRSQQLSQRAPGTGRFNSADMVDFMLLALLNRQLGLHAHLQHLPLLHPETLYSHWLQLAAELATWTEAR
TPDAFPLYDHDDLQGCFSRLTLLLRQGLSQVMEESAIQLPLTQRSHGLNVATVPDNSMVREFGFVLAVKA
NVPADALKTHFPAQMKVAPVTKIRDLVQLQLPGLALKAMPGAPPQIPWHAGYSYFELDKNSELWQEMERS
GAFALHLAGEFPGLNMEFWAIRSQSE
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1820525-1821865 Pantoea ananatis LMG 5342, complete genome
ATGAACAGAGCCGAAAAGGTTGTTTGGGCGGAAGGGATGTTTTTACGTCCTCACCATTTCCAGCAGGCAG
AAAACTTTCTGCAAAGCTCGCTGCGTGAATGGGGCCAGTCGCAACGCCCTTATGTTTGGGGATTTTTCGA
TCTCGAATTTGATGAAGCGCTGTTGCGGCAGGGTAAACTGGCACTGAGCGCCGCCAGTGGATGCCTGCCG
GATGGAACGTTTTTTGCCTTCAGTCAGCCACAACACGGCCCTGCGCCGCTGGACGTTCCCAGCAATACCG
ACCGCGCCAAAGTGGTTTTGGCCATTCCCGCTCGCCGCAATGGTCGCGAGGCGGTGACGTTTCAGGACGC
GCCTGATTCGCTGGCTCGCTATCTGGCCTGGGAAGCGGAAGTTGAAGATGACAATGCGCAGGCTGTCGGA
ACGGCCACCGTTCAGTTTGGCAAGCTGCGCCTCCGCTTGATGCTGGAGCAGGATCTCACGGCGGAATGGA
CGGCGATGGGCGTTGCTCAGATCGTTGAAAAGCGCAGCGACAACCATATCCGTTTAGACAATGATTATAT
CCCTCCCACGTTAACCCTTGCTGGCAGTCGTCCGCTTCAGAGCATGATGACCGACCTGCACGGCATGATT
CAACAACGTAGCCAGCAGCTGAGCCAGCGCGCACCCGGAACGGGCCGCTTTAACAGCGCGGATATGGTTG
ATTTTATGCTGCTGGCGTTGCTTAACCGCCAGTTGGGCCTTCATGCGCATCTGCAGCATCTGCCGCTATT
ACATCCTGAAACCCTCTACAGCCACTGGCTGCAGCTGGCTGCTGAGCTGGCAACGTGGACAGAGGCGCGC
ACGCCGGATGCTTTCCCTCTCTATGACCACGACGACCTGCAGGGCTGCTTCTCGCGCCTGACGCTATTGC
TCCGTCAAGGCCTGTCGCAGGTGATGGAAGAGAGTGCCATTCAGTTGCCGCTGACGCAACGCTCACACGG
CCTGAATGTGGCGACCGTGCCGGATAACAGCATGGTGCGTGAATTCGGTTTTGTGCTGGCCGTAAAAGCA
AACGTCCCGGCCGACGCGCTGAAAACGCATTTCCCGGCGCAGATGAAAGTCGCCCCCGTCACCAAAATTC
GCGATCTCGTCCAACTGCAGCTACCGGGCCTTGCCCTGAAAGCCATGCCGGGTGCGCCACCGCAGATCCC
ATGGCACGCAGGATACAGCTATTTTGAGCTGGATAAGAACAGCGAGCTATGGCAGGAGATGGAGCGATCG
GGTGCCTTCGCGCTGCACCTTGCCGGTGAGTTTCCGGGCCTGAACATGGAGTTCTGGGCCATTCGCAGTC
AGTCAGAATAA