SecReT6
Protein ID: 378766691
SecReT6 ID536
T6SS typei3
Gene symbol-
Locus tagPANA5342_1724
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1821882..1823123 [+]
Producttype IV/VI secretion system protein, DotU family
NoteTssL
UniProt IDG9AQS6
KEGG IDplf:PANA5342_1724
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.30E-71, Aligned region: 21..226
OmpA [PF00691], Evalue: 1.80E-16, Aligned region: 291..389
Protein Sequence: 413 a.a.     [Download]
>gi|378766691|ref|YP_005195154.1| type IV/VI secretion system protein, DotU family [Pantoea ananatis LMG 5342]
MMQEQNKPNSDAFQQDLSHQNSLVAAANPLINAIPQIRHSVSHDDPARLRQQLIDQIRRFELACQQSGLS
YEVIVGARYCLCTALDEAAALTPWGSRGVWTSNGLLVTFHNETWGGEKFFQLLAKLSQNPRQHILLLELI
YFCLLLGFEGRYRVLDNGRSQLDTIKQRLLQMIRSVRGSFAAALSPHPTDQPVLRKLWRPMIPLWACAAL
AGLAACLFYIVLNWRLGDYTSPVLAKIYQTTLPEVQIRNPAPPPPPSLNLKSFLKPEIDEGLVAVRDEAD
QSVVTLKGDGLFASGSTEVRGRYDAVIQRVAEAMNNVSGKILVVGYSDNVPIRSARFASNYELSLARAQS
VQTLLQKQLAKPSRVKAEGRGETHPLVPNTSAENRARNRRVEITLQVAPDTTQAEVNGLARGN
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1821882-1823123 Pantoea ananatis LMG 5342, complete genome
ATGATGCAGGAACAAAATAAACCGAACAGTGATGCTTTTCAGCAGGATCTTAGCCACCAGAATAGTTTGG
TGGCTGCAGCGAATCCGCTGATTAACGCGATTCCACAGATTCGTCACTCCGTCTCCCATGACGATCCCGC
ACGTTTACGTCAACAGCTGATTGACCAGATCCGCCGTTTCGAGCTGGCCTGCCAGCAGTCCGGACTGAGC
TATGAGGTGATCGTTGGCGCGCGCTATTGTCTGTGTACGGCGCTTGATGAAGCCGCAGCACTGACGCCCT
GGGGAAGCCGTGGCGTGTGGACCAGTAATGGCTTACTGGTCACCTTCCACAACGAAACCTGGGGCGGGGA
GAAATTCTTCCAACTGCTGGCGAAACTGTCGCAAAACCCGCGTCAGCACATCCTGTTACTGGAGCTGATC
TATTTCTGCTTACTGCTTGGTTTTGAAGGGCGCTATCGGGTTCTGGATAATGGACGCTCGCAACTGGATA
CGATTAAACAGCGTCTGTTGCAGATGATCAGGAGCGTCAGGGGCAGCTTTGCCGCCGCCTTGTCGCCGCA
TCCGACCGATCAGCCGGTTCTGCGTAAACTCTGGCGCCCCATGATTCCGCTGTGGGCCTGTGCGGCTCTG
GCGGGCCTGGCTGCCTGCCTGTTCTATATCGTGCTGAACTGGCGTCTGGGGGATTACACCTCGCCCGTGC
TGGCCAAAATCTACCAAACGACGCTGCCAGAAGTGCAGATTCGTAATCCGGCACCGCCGCCGCCGCCGTC
ACTGAACCTGAAGTCATTCCTGAAACCTGAAATCGACGAAGGCCTGGTGGCCGTGCGCGATGAGGCAGAT
CAAAGTGTGGTGACGCTGAAAGGCGATGGCTTGTTCGCATCCGGTTCGACAGAGGTTCGCGGACGTTATG
ATGCCGTTATCCAGCGTGTAGCTGAAGCCATGAATAACGTCAGCGGGAAAATCCTGGTGGTGGGCTACAG
CGATAACGTACCGATTCGCAGTGCCCGATTTGCCTCCAACTATGAGCTGTCTCTGGCCCGTGCCCAGTCT
GTTCAGACGCTGTTACAAAAACAGCTGGCAAAACCATCACGCGTTAAAGCGGAAGGGCGGGGTGAAACGC
ATCCGTTGGTGCCGAATACCAGTGCAGAAAATCGCGCGCGTAATCGTCGTGTTGAAATTACGCTGCAGGT
TGCACCTGATACGACGCAAGCTGAAGTTAACGGCCTGGCGAGAGGGAACTAA