SecReT6
Protein ID: 378766694
SecReT6 ID536
T6SS typei3
Gene symbolimpA
Locus tagPANA5342_1727
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1827492..1828514 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDG9AQS9
KEGG IDplf:PANA5342_1727
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-20, Aligned region: 54..113
Protein Sequence: 340 a.a.     [Download]
>gi|378766694|ref|YP_005195157.1| type VI secretion-associated protein, ImpA family [Pantoea ananatis LMG 5342]
MSIDIDTLLIPVSHDNPCGENLEYDADFQAMEQASVGKAEQQFGNTIIPAEPADWNKVEKLALELMSRSK
DLRVMLTLTHAWTRLKGLPGYAQGLQLIEQAMLQFWEPLWPRLEEDGEHDPFYRINALAVLGDQSALTAA
VRQSWLMRYASDGITLRDASALCDGSKTEVPDYPGGLPRLNDELARGEQPGIAAIQNIAERLQNIRRIVI
EKLDETALPDMSQLQRSMAMLNERCQATDMESLHSLAAAMQSAPATEQQPSVAAPRAATDWRSAQLNSRA
EAQLMLEKVKQYFSQHEPSHPAPLMIDRVQRLIELDFMDIIRDLAPDGVHQLENIFGRRD
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1827492-1828514 Pantoea ananatis LMG 5342, complete genome
ATGAGTATTGATATTGACACGTTGCTGATACCGGTAAGCCATGATAATCCGTGCGGTGAAAACCTGGAGT
ACGACGCGGACTTTCAGGCGATGGAGCAGGCCAGCGTGGGAAAAGCCGAACAGCAGTTCGGTAACACCAT
TATTCCGGCTGAGCCAGCGGACTGGAACAAAGTTGAAAAGCTTGCACTGGAACTGATGAGCCGCAGCAAA
GACCTGCGTGTCATGCTGACCCTGACACATGCCTGGACGCGCCTGAAAGGGTTACCGGGCTATGCACAGG
GCCTGCAACTGATTGAACAGGCGATGTTGCAGTTCTGGGAACCGCTCTGGCCTCGCCTTGAAGAAGATGG
CGAGCACGATCCGTTTTACCGCATCAACGCGCTGGCTGTGCTGGGCGATCAGTCGGCACTTACGGCCGCC
GTTCGTCAGTCATGGCTCATGCGCTATGCGTCCGATGGTATTACGCTGCGTGATGCTTCGGCGCTGTGTG
ACGGCAGTAAAACAGAGGTGCCAGATTATCCGGGTGGGCTGCCGCGTCTGAATGACGAACTTGCACGAGG
GGAACAACCGGGCATCGCAGCGATTCAAAACATTGCTGAGCGTTTGCAAAATATTCGCCGCATCGTGATT
GAAAAGCTGGATGAAACGGCCTTGCCGGATATGAGTCAGCTGCAACGCAGCATGGCAATGCTGAATGAGC
GCTGTCAGGCCACGGATATGGAATCGTTACACTCCCTGGCGGCGGCGATGCAATCCGCACCCGCAACGGA
GCAGCAGCCCAGCGTCGCTGCACCACGTGCGGCTACCGACTGGCGCAGTGCCCAACTGAATTCGCGGGCA
GAAGCCCAACTTATGCTGGAAAAGGTCAAACAGTACTTTAGTCAGCATGAGCCGAGCCACCCGGCACCGC
TGATGATTGACAGGGTACAGCGCCTTATCGAACTCGATTTTATGGACATCATTCGCGATCTCGCGCCCGA
TGGTGTGCATCAGTTAGAAAACATTTTTGGACGCCGCGACTAA