SecReT6
Protein ID: 378766695
SecReT6 ID536
T6SS typei3
Gene symbol-
Locus tagPANA5342_1728
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1828595..1829125 [+]
Producttype VI secretion system, core protein
NoteTssB
UniProt IDG9AQT0
KEGG IDplf:PANA5342_1728
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.70E-61, Aligned region: 12..164
Protein Sequence: 176 a.a.     [Download]
>gi|378766695|ref|YP_005195158.1| type VI secretion system, core protein [Pantoea ananatis LMG 5342]
MPTMKSSGQKFIARNRAPRVQIEYDVEVYGAERKIQLPFIMGVLADLAGKPLEPQASVDDRKFMEIDIDN
FDERMKAMKPRAAFQVDNTLNGDGKLNIDLTFESMDDFSPDAIARKVDPLNSLLEARTQLSNLLTYMDGK
NGAEELIGKILQDPTLLQALSHVPKQTDAPEGKEEQ
 
Nucleotide Sequence: 531 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1828595-1829125 Pantoea ananatis LMG 5342, complete genome
ATGCCAACAATGAAGTCCAGTGGGCAGAAATTTATCGCCCGCAATCGCGCGCCACGCGTTCAGATTGAAT
ATGACGTGGAAGTCTATGGCGCAGAACGTAAAATTCAGCTGCCATTCATCATGGGTGTTCTGGCCGATTT
AGCCGGTAAACCGCTGGAGCCGCAGGCCAGCGTTGACGACCGTAAATTCATGGAAATCGACATCGACAAT
TTCGATGAGCGTATGAAAGCCATGAAGCCACGTGCGGCATTCCAGGTAGACAATACGTTGAACGGTGACG
GCAAACTGAACATCGATCTGACCTTCGAAAGCATGGACGATTTTTCTCCTGATGCCATTGCACGCAAAGT
CGATCCACTCAACAGCCTGCTTGAAGCACGTACCCAGCTCTCCAACCTGCTGACCTATATGGACGGCAAA
AACGGCGCCGAAGAGCTGATCGGCAAGATTTTACAGGATCCGACACTGCTGCAGGCCCTGTCACACGTGC
CTAAGCAAACGGATGCCCCTGAAGGTAAGGAGGAGCAGTAA