SecReT6
Protein ID: 378766696
SecReT6 ID536
T6SS typei3
Gene symbol-
Locus tagPANA5342_1729
StrainPantoea ananatis LMG 5342
Repliconchromosome [GenBank: NC_016816] [Browse all T6SS(s) in this replicon]
Location [Strand]1829125..1830624 [+]
Producttype VI secretion system, core protein
NoteTssC
UniProt IDG9AQT1
KEGG IDplf:PANA5342_1729
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.80E-198, Aligned region: 66..492
Protein Sequence: 499 a.a.     [Download]
>gi|378766696|ref|YP_005195159.1| type VI secretion system, core protein [Pantoea ananatis LMG 5342]
MNQTSQQPQSQGGASFSQDEFSALLNKEFRPKSDQAREAVESAVKTLAQQALENTVTMSSDAYRTIQALI
AEIDEKLSQQVNQIIHHDDFQKLESAWRGLSYLVNNTETDEMLKIRFMSISKQELSRTLKRYKGVGWDQS
PLFKKIYEQEYGQFGGEPFGCLVGDYYFDHSPQDVELLGEMARIGAAAHCPFITGTAPSVMQMESWQELA
NPRDLTKIFQNTEYAAWRSLRESEDARYLGLVMPRFLSRLPYGIRTNPVDSFDFEEQTDGSDHSNYSWTN
AAYAMATNINRSFKEYGWCTSIRGVESGGAVEDLPCHTFPSDDGGVDMKCPTEIAISDRREAELAKNGFM
PLVHRKNSDFAAFIGAQSLQKPAEYHDADATANARLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDEM
ERWLNDWVMNYVDGDPANSSQETKSRKPLAAAEVNVEEQEDNLGYYAAKFFLRPHYQLEGLTVSLRLVSK
LPSLKSNEN
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|378764971|ref|NC_016816.1|:1829125-1830624 Pantoea ananatis LMG 5342, complete genome
ATGAACCAGACTTCTCAACAACCACAATCGCAGGGCGGTGCCAGCTTTAGTCAGGATGAGTTCAGCGCGT
TACTGAACAAAGAATTCCGTCCTAAAAGCGACCAGGCACGCGAAGCTGTAGAAAGCGCGGTAAAAACCCT
GGCGCAGCAGGCGCTGGAAAACACCGTGACCATGTCCAGCGATGCCTACCGCACCATTCAGGCGCTGATC
GCTGAGATTGACGAAAAGCTGTCTCAGCAGGTTAACCAGATCATCCACCATGATGACTTTCAGAAGCTGG
AAAGCGCCTGGCGTGGTCTGAGCTATCTGGTGAATAACACCGAAACTGATGAGATGCTCAAGATTCGCTT
TATGAGCATCTCCAAGCAGGAACTGAGCCGCACTCTGAAACGCTATAAAGGCGTGGGCTGGGATCAGAGC
CCGCTGTTCAAGAAAATCTACGAGCAGGAATATGGCCAGTTTGGTGGTGAACCTTTTGGCTGCCTGGTGG
GCGACTACTATTTCGATCACAGCCCGCAGGACGTTGAGCTGCTGGGCGAGATGGCGCGTATCGGTGCTGC
AGCACACTGTCCGTTTATCACCGGTACTGCACCAAGCGTGATGCAGATGGAATCCTGGCAGGAACTGGCA
AACCCACGCGATCTGACCAAAATCTTCCAGAATACCGAATATGCTGCCTGGCGTAGCCTGCGCGAGTCTG
AAGACGCGCGCTATCTGGGCCTGGTGATGCCGCGCTTCCTGTCTCGTCTGCCTTACGGTATTCGCACCAA
CCCCGTGGACAGCTTTGATTTTGAAGAGCAGACCGACGGTTCCGACCACAGCAACTACAGCTGGACCAAC
GCGGCTTATGCCATGGCGACTAACATCAACCGTTCCTTCAAGGAGTACGGCTGGTGTACATCTATTCGCG
GCGTGGAGTCGGGTGGGGCCGTTGAAGATCTGCCTTGCCACACGTTCCCAAGCGATGACGGCGGCGTAGA
CATGAAATGCCCAACGGAAATCGCCATCAGCGATCGCCGCGAAGCCGAGCTCGCGAAGAATGGCTTTATG
CCGTTAGTTCACCGCAAAAACTCTGACTTTGCCGCCTTTATCGGCGCCCAGTCGCTGCAAAAACCTGCGG
AGTACCACGATGCTGACGCCACCGCCAATGCGCGTCTGGCAGCGCGGCTGCCTTATCTGTTCGCCTGCTG
CCGTTTCGCTCACTATCTGAAGTGTATTGTGCGCGACAAGATTGGTTCCTTCCGCGAGCGCGACGAAATG
GAACGCTGGTTGAACGACTGGGTGATGAACTATGTCGATGGTGACCCGGCTAACTCTTCTCAGGAAACCA
AGTCTCGTAAGCCGCTGGCTGCTGCAGAAGTGAATGTGGAAGAGCAGGAGGACAACCTAGGCTACTATGC
TGCAAAATTCTTCCTGCGTCCGCATTACCAGTTGGAAGGGTTAACCGTTTCGCTGCGTCTGGTATCGAAA
CTGCCTTCGCTGAAGTCGAACGAAAACTAA